Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PanAT/DUF4065(antitoxin) |
| Location | 4736030..4737018 | Replicon | chromosome |
| Accession | NZ_CP109874 | ||
| Organism | Escherichia coli strain EC488 | ||
Toxin (Protein)
| Gene name | panT | Uniprot ID | - |
| Locus tag | NQ150_RS22950 | Protein ID | WP_014640052.1 |
| Coordinates | 4736030..4736416 (-) | Length | 129 a.a. |
Antitoxin (Protein)
| Gene name | panA | Uniprot ID | A0A0A1AFM1 |
| Locus tag | NQ150_RS22955 | Protein ID | WP_000458583.1 |
| Coordinates | 4736446..4737018 (-) | Length | 191 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NQ150_RS22915 (4731595) | 4731595..4731795 | - | 201 | WP_021527487.1 | YdaS family helix-turn-helix protein | - |
| NQ150_RS22920 (4731886) | 4731886..4732560 | + | 675 | WP_021530636.1 | LexA family transcriptional regulator | - |
| NQ150_RS22925 (4733228) | 4733228..4733590 | + | 363 | WP_000135680.1 | protein YfdP | - |
| NQ150_RS22930 (4733656) | 4733656..4734480 | + | 825 | WP_023908886.1 | DUF2303 family protein | - |
| NQ150_RS22935 (4734669) | 4734669..4735451 | + | 783 | WP_023908887.1 | hypothetical protein | - |
| NQ150_RS22940 (4735488) | 4735488..4735769 | + | 282 | WP_001093916.1 | pyocin activator PrtN family protein | - |
| NQ150_RS22945 (4735817) | 4735817..4735990 | - | 174 | WP_023908888.1 | hypothetical protein | - |
| NQ150_RS22950 (4736030) | 4736030..4736416 | - | 387 | WP_014640052.1 | hypothetical protein | Toxin |
| NQ150_RS22955 (4736446) | 4736446..4737018 | - | 573 | WP_000458583.1 | Panacea domain-containing protein | Antitoxin |
| NQ150_RS22960 (4737272) | 4737272..4737376 | - | 105 | Protein_4500 | tRNA-dihydrouridine synthase | - |
| NQ150_RS22965 (4737738) | 4737738..4738742 | - | 1005 | WP_022646425.1 | DUF2713 family protein | - |
| NQ150_RS22970 (4739060) | 4739060..4739575 | + | 516 | WP_000416263.1 | zinc uptake transcriptional repressor Zur | - |
| NQ150_RS22975 (4739617) | 4739617..4739826 | - | 210 | WP_001296638.1 | CsbD family protein | - |
| NQ150_RS22980 (4739942) | 4739942..4741267 | - | 1326 | WP_001361471.1 | MATE family efflux transporter DinF | - |
| NQ150_RS22985 (4741340) | 4741340..4741948 | - | 609 | WP_000646078.1 | transcriptional repressor LexA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 4693972..4741948 | 47976 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14465.40 Da Isoelectric Point: 5.4833
>T262265 WP_014640052.1 NZ_CP109874:c4736416-4736030 [Escherichia coli]
VLAPTGPCNHLHVICNDPVYYPVNDCYCVLVVNISSIKDGVPHDPSCVLNSGDHRFIKHPSYVVYAEAIIWRVDNMVRKQ
RSGEISVHDDMPEATFNRILDGFDISDEVTPKNLKFKNKYCVSSIDDE
VLAPTGPCNHLHVICNDPVYYPVNDCYCVLVVNISSIKDGVPHDPSCVLNSGDHRFIKHPSYVVYAEAIIWRVDNMVRKQ
RSGEISVHDDMPEATFNRILDGFDISDEVTPKNLKFKNKYCVSSIDDE
Download Length: 387 bp
Antitoxin
Download Length: 191 a.a. Molecular weight: 21956.30 Da Isoelectric Point: 6.0283
>AT262265 WP_000458583.1 NZ_CP109874:c4737018-4736446 [Escherichia coli]
MFCEEKVAQMAAYLLLKRGGRMAYLKLMKLLYLSNRKSILKHGRMIGEDSLYSMKFGPVMSNTLNLIRGKAEGIGDYWYN
LIETNGHDVLLRSDPREMDADEVFDELSRADIRILDEIYSLYGHMNRFDLANMTHLESVCPEWHNPGNSRKPIDLKEMLI
SEGKSEDEANRIIGKMEESQKLKEFSLQLS
MFCEEKVAQMAAYLLLKRGGRMAYLKLMKLLYLSNRKSILKHGRMIGEDSLYSMKFGPVMSNTLNLIRGKAEGIGDYWYN
LIETNGHDVLLRSDPREMDADEVFDELSRADIRILDEIYSLYGHMNRFDLANMTHLESVCPEWHNPGNSRKPIDLKEMLI
SEGKSEDEANRIIGKMEESQKLKEFSLQLS
Download Length: 573 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|