Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4598253..4599085 | Replicon | chromosome |
| Accession | NZ_CP109874 | ||
| Organism | Escherichia coli strain EC488 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1PD64 |
| Locus tag | NQ150_RS22240 | Protein ID | WP_000854753.1 |
| Coordinates | 4598711..4599085 (+) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | S1NQ68 |
| Locus tag | NQ150_RS22235 | Protein ID | WP_001540478.1 |
| Coordinates | 4598253..4598621 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NQ150_RS22200 (4594085) | 4594085..4594765 | + | 681 | WP_001282919.1 | WYL domain-containing protein | - |
| NQ150_RS22205 (4594913) | 4594913..4595590 | + | 678 | WP_001097301.1 | hypothetical protein | - |
| NQ150_RS22210 (4595596) | 4595596..4595829 | + | 234 | WP_001278283.1 | DUF905 family protein | - |
| NQ150_RS22215 (4595919) | 4595919..4596737 | + | 819 | WP_023909075.1 | DUF932 domain-containing protein | - |
| NQ150_RS22220 (4596829) | 4596829..4597314 | + | 486 | WP_001586019.1 | antirestriction protein | - |
| NQ150_RS22225 (4597330) | 4597330..4597806 | + | 477 | WP_001186773.1 | RadC family protein | - |
| NQ150_RS22230 (4597869) | 4597869..4598090 | + | 222 | WP_000692311.1 | DUF987 domain-containing protein | - |
| NQ150_RS22235 (4598253) | 4598253..4598621 | + | 369 | WP_001540478.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| NQ150_RS22240 (4598711) | 4598711..4599085 | + | 375 | WP_000854753.1 | TA system toxin CbtA family protein | Toxin |
| NQ150_RS22245 (4599082) | 4599082..4599570 | + | 489 | WP_000777545.1 | DUF5983 family protein | - |
| NQ150_RS22250 (4599582) | 4599582..4599779 | + | 198 | WP_000839281.1 | DUF957 domain-containing protein | - |
| NQ150_RS22255 (4599876) | 4599876..4600445 | + | 570 | WP_001290252.1 | DUF4942 domain-containing protein | - |
| NQ150_RS22260 (4601194) | 4601194..4602732 | + | 1539 | WP_023908864.1 | lysine decarboxylation/transport transcriptional activator CadC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | papX / papF / papE / papK / papJ / papD / papC / papH / papA / papI | 4569434..4610545 | 41111 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 14005.00 Da Isoelectric Point: 8.2905
>T262263 WP_000854753.1 NZ_CP109874:4598711-4599085 [Escherichia coli]
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13652.53 Da Isoelectric Point: 7.8398
>AT262263 WP_001540478.1 NZ_CP109874:4598253-4598621 [Escherichia coli]
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9LVU0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1NQ68 |