Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
Location | 4466999..4467594 | Replicon | chromosome |
Accession | NZ_CP109874 | ||
Organism | Escherichia coli strain EC488 |
Toxin (Protein)
Gene name | chpB | Uniprot ID | V0SXT4 |
Locus tag | NQ150_RS21560 | Protein ID | WP_000239581.1 |
Coordinates | 4466999..4467349 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | chpS | Uniprot ID | L4JJX7 |
Locus tag | NQ150_RS21565 | Protein ID | WP_001223213.1 |
Coordinates | 4467343..4467594 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NQ150_RS21540 (4462453) | 4462453..4463475 | - | 1023 | WP_001298067.1 | ABC transporter permease | - |
NQ150_RS21545 (4463489) | 4463489..4464991 | - | 1503 | WP_022646474.1 | sugar ABC transporter ATP-binding protein | - |
NQ150_RS21550 (4465124) | 4465124..4466080 | - | 957 | WP_000265933.1 | galactofuranose ABC transporter substrate-binding protein YtfQ | - |
NQ150_RS21555 (4466390) | 4466390..4466920 | + | 531 | WP_000055075.1 | inorganic diphosphatase | - |
NQ150_RS21560 (4466999) | 4466999..4467349 | - | 351 | WP_000239581.1 | endoribonuclease toxin ChpB | Toxin |
NQ150_RS21565 (4467343) | 4467343..4467594 | - | 252 | WP_001223213.1 | type II toxin-antitoxin system antitoxin ChpS | Antitoxin |
NQ150_RS21570 (4467806) | 4467806..4468147 | - | 342 | WP_001219160.1 | gamma-glutamylcyclotransferase | - |
NQ150_RS21575 (4468150) | 4468150..4471929 | - | 3780 | WP_022646473.1 | autotransporter assembly complex protein TamB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12453.41 Da Isoelectric Point: 6.2206
>T262262 WP_000239581.1 NZ_CP109874:c4467349-4466999 [Escherichia coli]
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAAGEVVEEALLRLQAVVE
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAAGEVVEEALLRLQAVVE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|