Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 4161255..4161805 Replicon chromosome
Accession NZ_CP109874
Organism Escherichia coli strain EC488

Toxin (Protein)


Gene name ccdB Uniprot ID S1PDG4
Locus tag NQ150_RS20070 Protein ID WP_001160966.1
Coordinates 4161255..4161569 (-) Length 105 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID S1NMQ0
Locus tag NQ150_RS20075 Protein ID WP_000125568.1
Coordinates 4161572..4161805 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NQ150_RS20045 (4156930) 4156930..4158216 + 1287 WP_000800457.1 peptidylprolyl isomerase SurA -
NQ150_RS20050 (4158216) 4158216..4159205 + 990 WP_000241224.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
NQ150_RS20055 (4159202) 4159202..4160023 + 822 WP_001065381.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
NQ150_RS20060 (4160026) 4160026..4160403 + 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
NQ150_RS20065 (4160410) 4160410..4161258 + 849 WP_000257195.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
NQ150_RS20070 (4161255) 4161255..4161569 - 315 WP_001160966.1 CcdB family protein Toxin
NQ150_RS20075 (4161572) 4161572..4161805 - 234 WP_000125568.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
NQ150_RS20080 (4161891) 4161891..4162370 - 480 WP_000624375.1 type 3 dihydrofolate reductase -
NQ150_RS20085 (4162562) 4162562..4164424 - 1863 WP_022645165.1 glutathione-regulated potassium-efflux system protein KefC -
NQ150_RS20090 (4164417) 4164417..4164947 - 531 WP_000600732.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
NQ150_RS20095 (4165055) 4165055..4166386 - 1332 WP_001183201.1 MFS transporter -
NQ150_RS20100 (4166444) 4166444..4166731 - 288 WP_000203741.1 ferredoxin-like protein FixX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-103)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11711.72 Da        Isoelectric Point: 9.0851

>T262256 WP_001160966.1 NZ_CP109874:c4161569-4161255 [Escherichia coli]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSRIRPPERLNPILLLVDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIKGALDFMLDGI

Download         Length: 315 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8560.55 Da        Isoelectric Point: 5.8062

>AT262256 WP_000125568.1 NZ_CP109874:c4161805-4161572 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENTEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829G815

Antitoxin

Source ID Structure
AlphaFold DB A0A829GEF2

References