Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3739787..3740405 | Replicon | chromosome |
Accession | NZ_CP109874 | ||
Organism | Escherichia coli strain EC488 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | NQ150_RS18085 | Protein ID | WP_001291435.1 |
Coordinates | 3740187..3740405 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | NQ150_RS18080 | Protein ID | WP_000344800.1 |
Coordinates | 3739787..3740161 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NQ150_RS18070 (3734876) | 3734876..3736069 | + | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
NQ150_RS18075 (3736092) | 3736092..3739241 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
NQ150_RS18080 (3739787) | 3739787..3740161 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
NQ150_RS18085 (3740187) | 3740187..3740405 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
NQ150_RS18090 (3740577) | 3740577..3741128 | + | 552 | WP_000102574.1 | maltose O-acetyltransferase | - |
NQ150_RS18095 (3741244) | 3741244..3741714 | + | 471 | WP_022645280.1 | YlaC family protein | - |
NQ150_RS18100 (3741878) | 3741878..3743428 | + | 1551 | WP_022645279.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
NQ150_RS18105 (3743470) | 3743470..3743823 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
NQ150_RS18115 (3744202) | 3744202..3744513 | + | 312 | WP_000409911.1 | MGMT family protein | - |
NQ150_RS18120 (3744544) | 3744544..3745116 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T262254 WP_001291435.1 NZ_CP109874:3740187-3740405 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT262254 WP_000344800.1 NZ_CP109874:3739787-3740161 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |