Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-HTH_XRE |
Location | 3297030..3297735 | Replicon | chromosome |
Accession | NZ_CP109874 | ||
Organism | Escherichia coli strain EC488 |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1F406 |
Locus tag | NQ150_RS15890 | Protein ID | WP_000539521.1 |
Coordinates | 3297030..3297416 (+) | Length | 129 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | NQ150_RS15895 | Protein ID | WP_001280945.1 |
Coordinates | 3297406..3297735 (+) | Length | 110 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NQ150_RS15870 (3293034) | 3293034..3293660 | + | 627 | WP_001295292.1 | glutathione S-transferase GstB | - |
NQ150_RS15875 (3293657) | 3293657..3294772 | - | 1116 | WP_000554964.1 | aldose sugar dehydrogenase YliI | - |
NQ150_RS15880 (3294883) | 3294883..3295266 | - | 384 | WP_000497137.1 | biofilm formation regulator BssR | - |
NQ150_RS15885 (3295479) | 3295479..3296804 | + | 1326 | WP_000049367.1 | 30S ribosomal protein S12 methylthiotransferase RimO | - |
NQ150_RS15890 (3297030) | 3297030..3297416 | + | 387 | WP_000539521.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NQ150_RS15895 (3297406) | 3297406..3297735 | + | 330 | WP_001280945.1 | DNA-binding transcriptional regulator | Antitoxin |
NQ150_RS15900 (3297805) | 3297805..3299133 | - | 1329 | WP_022645414.1 | GGDEF domain-containing protein | - |
NQ150_RS15905 (3299141) | 3299141..3301489 | - | 2349 | WP_022645413.1 | EAL domain-containing protein | - |
NQ150_RS15910 (3301666) | 3301666..3302577 | - | 912 | WP_001236044.1 | glutathione ABC transporter permease GsiD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14293.45 Da Isoelectric Point: 9.9296
>T262252 WP_000539521.1 NZ_CP109874:3297030-3297416 [Escherichia coli]
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|