Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 3041221..3042005 | Replicon | chromosome |
Accession | NZ_CP109874 | ||
Organism | Escherichia coli strain EC488 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | V0T0H9 |
Locus tag | NQ150_RS14680 | Protein ID | WP_000613626.1 |
Coordinates | 3041511..3042005 (+) | Length | 165 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | A0A0A1AEM7 |
Locus tag | NQ150_RS14675 | Protein ID | WP_024946541.1 |
Coordinates | 3041221..3041514 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NQ150_RS14665 (3036382) | 3036382..3037341 | - | 960 | WP_022645527.1 | 23S rRNA pseudouridine(955/2504/2580) synthase RluC | - |
NQ150_RS14670 (3037914) | 3037914..3041087 | + | 3174 | WP_022645526.1 | ribonuclease E | - |
NQ150_RS14675 (3041221) | 3041221..3041514 | + | 294 | WP_024946541.1 | DUF1778 domain-containing protein | Antitoxin |
NQ150_RS14680 (3041511) | 3041511..3042005 | + | 495 | WP_000613626.1 | GNAT family N-acetyltransferase | Toxin |
NQ150_RS14685 (3042100) | 3042100..3043053 | - | 954 | WP_022645524.1 | flagellar hook-associated protein FlgL | - |
NQ150_RS14690 (3043065) | 3043065..3044708 | - | 1644 | WP_022645523.1 | flagellar hook-associated protein FlgK | - |
NQ150_RS14695 (3044774) | 3044774..3045715 | - | 942 | WP_001317765.1 | flagellar assembly peptidoglycan hydrolase FlgJ | - |
NQ150_RS14700 (3045715) | 3045715..3046812 | - | 1098 | WP_022645522.1 | flagellar basal body P-ring protein FlgI | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 165 a.a. Molecular weight: 18084.00 Da Isoelectric Point: 8.2617
>T262251 WP_000613626.1 NZ_CP109874:3041511-3042005 [Escherichia coli]
MIQAPEPLMARHQFTSFCSGVETMDNWLKQRALKNQLAGASRTFVSCDTYSNVLAYYSLASSAVETYVATGRFRRNMPEP
IPVVVLGRLAIDKSLQGQGIGRAMVRDAGLRVLQAAEVIGIRGMLVHALSDQAREFYLRVGFEPSPVDSMILMATLADLQ
ECLK
MIQAPEPLMARHQFTSFCSGVETMDNWLKQRALKNQLAGASRTFVSCDTYSNVLAYYSLASSAVETYVATGRFRRNMPEP
IPVVVLGRLAIDKSLQGQGIGRAMVRDAGLRVLQAAEVIGIRGMLVHALSDQAREFYLRVGFEPSPVDSMILMATLADLQ
ECLK
Download Length: 495 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V0T0H9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0A1AEM7 |