Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 934270..934924 | Replicon | chromosome |
Accession | NZ_CP109874 | ||
Organism | Escherichia coli strain EC488 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1PAM6 |
Locus tag | NQ150_RS04495 | Protein ID | WP_000244781.1 |
Coordinates | 934517..934924 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | NQ150_RS04490 | Protein ID | WP_000354046.1 |
Coordinates | 934270..934536 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NQ150_RS04465 (929548) | 929548..930291 | + | 744 | WP_000951948.1 | SDR family oxidoreductase | - |
NQ150_RS04470 (930348) | 930348..931781 | - | 1434 | WP_141073354.1 | 6-phospho-beta-glucosidase BglA | - |
NQ150_RS04475 (931826) | 931826..932137 | + | 312 | WP_001182953.1 | N(4)-acetylcytidine aminohydrolase | - |
NQ150_RS04480 (932301) | 932301..932960 | + | 660 | WP_000250269.1 | hemolysin III family protein | - |
NQ150_RS04485 (933037) | 933037..934017 | - | 981 | WP_000886050.1 | tRNA-modifying protein YgfZ | - |
NQ150_RS04490 (934270) | 934270..934536 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
NQ150_RS04495 (934517) | 934517..934924 | + | 408 | WP_000244781.1 | protein YgfX | Toxin |
NQ150_RS04500 (934964) | 934964..935485 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
NQ150_RS04505 (935597) | 935597..936493 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
NQ150_RS04510 (936518) | 936518..937228 | + | 711 | WP_000715222.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
NQ150_RS04515 (937234) | 937234..938967 | + | 1734 | WP_000813233.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T262243 WP_000244781.1 NZ_CP109874:934517-934924 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S1PAM6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QD57 |