Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 843037..843872 | Replicon | chromosome |
| Accession | NZ_CP109874 | ||
| Organism | Escherichia coli strain EC488 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1EZ92 |
| Locus tag | NQ150_RS04020 | Protein ID | WP_000854726.1 |
| Coordinates | 843037..843414 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | NQ150_RS04025 | Protein ID | WP_001377046.1 |
| Coordinates | 843504..843872 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NQ150_RS03990 (838472) | 838472..840007 | - | 1536 | WP_000492888.1 | EAL domain-containing protein | - |
| NQ150_RS03995 (840078) | 840078..840922 | - | 845 | Protein_785 | DUF4942 domain-containing protein | - |
| NQ150_RS04000 (841007) | 841007..841093 | - | 87 | Protein_786 | hypothetical protein | - |
| NQ150_RS04010 (842418) | 842418..842540 | - | 123 | Protein_788 | hypothetical protein | - |
| NQ150_RS04015 (842552) | 842552..843040 | - | 489 | WP_000761657.1 | DUF5983 family protein | - |
| NQ150_RS04020 (843037) | 843037..843414 | - | 378 | WP_000854726.1 | TA system toxin CbtA family protein | Toxin |
| NQ150_RS04025 (843504) | 843504..843872 | - | 369 | WP_001377046.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| NQ150_RS04030 (843946) | 843946..844167 | - | 222 | WP_000692346.1 | DUF987 domain-containing protein | - |
| NQ150_RS04035 (844230) | 844230..844706 | - | 477 | WP_001347688.1 | RadC family protein | - |
| NQ150_RS04040 (844722) | 844722..845207 | - | 486 | WP_029701480.1 | antirestriction protein | - |
| NQ150_RS04045 (845262) | 845262..846080 | - | 819 | WP_001234642.1 | DUF932 domain-containing protein | - |
| NQ150_RS04050 (846180) | 846180..846413 | - | 234 | WP_001119719.1 | DUF905 family protein | - |
| NQ150_RS04055 (846492) | 846492..846947 | - | 456 | WP_000581493.1 | IrmA family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14164.10 Da Isoelectric Point: 7.8045
>T262242 WP_000854726.1 NZ_CP109874:c843414-843037 [Escherichia coli]
MKTLPDTHVREASRCPSPVTIWQTLLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITQGKHPEAKQ
MKTLPDTHVREASRCPSPVTIWQTLLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITQGKHPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13584.37 Da Isoelectric Point: 6.6255
>AT262242 WP_001377046.1 NZ_CP109874:c843872-843504 [Escherichia coli]
VSDTLSGTTHPDDNDDRLWWGLPCTVTPCFGARLVQKGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGVTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDRLWWGLPCTVTPCFGARLVQKGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGVTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|