Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemIK/MazF(toxin) |
| Location | 248527..249169 | Replicon | chromosome |
| Accession | NZ_CP109872 | ||
| Organism | Bacillus cereus strain BC38B | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | J8CWW5 |
| Locus tag | OK229_RS01405 | Protein ID | WP_000635963.1 |
| Coordinates | 248819..249169 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | R8I8H2 |
| Locus tag | OK229_RS01400 | Protein ID | WP_000004570.1 |
| Coordinates | 248527..248814 (+) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OK229_RS01375 (OK229_11205) | 243843..244805 | + | 963 | WP_000961155.1 | UV DNA damage repair endonuclease UvsE | - |
| OK229_RS01380 (OK229_11210) | 244798..245370 | - | 573 | WP_000906926.1 | rhomboid family intramembrane serine protease | - |
| OK229_RS01385 (OK229_11215) | 245463..245822 | + | 360 | WP_000635040.1 | holo-ACP synthase | - |
| OK229_RS01390 (OK229_11220) | 245979..246929 | + | 951 | WP_025388382.1 | outer membrane lipoprotein carrier protein LolA | - |
| OK229_RS01395 (OK229_11225) | 247048..248217 | + | 1170 | WP_000390600.1 | alanine racemase | - |
| OK229_RS01400 (OK229_11230) | 248527..248814 | + | 288 | WP_000004570.1 | antitoxin EndoAI | Antitoxin |
| OK229_RS01405 (OK229_11235) | 248819..249169 | + | 351 | WP_000635963.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
| OK229_RS01410 (OK229_11240) | 249237..251405 | + | 2169 | WP_264459790.1 | Tex family protein | - |
| OK229_RS01415 (OK229_11245) | 251464..251580 | - | 117 | WP_001143642.1 | cortex morphogenetic protein CmpA | - |
| OK229_RS01420 (OK229_11250) | 251776..252234 | + | 459 | WP_073526447.1 | SprT family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12974.12 Da Isoelectric Point: 5.7168
>T262238 WP_000635963.1 NZ_CP109872:248819-249169 [Bacillus cereus]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDEVMMIRVDEALQISLGLIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDEVMMIRVDEALQISLGLIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 4HKE | |
| PDB | 7BXY |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A366FY90 |