Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazF-pemI/MazF(toxin) |
| Location | 200383..201019 | Replicon | chromosome |
| Accession | NZ_CP109859 | ||
| Organism | Priestia megaterium strain 207 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | D5DWT4 |
| Locus tag | OHU65_RS01135 | Protein ID | WP_013055004.1 |
| Coordinates | 200669..201019 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | D5DWT3 |
| Locus tag | OHU65_RS01130 | Protein ID | WP_013055003.1 |
| Coordinates | 200383..200664 (+) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OHU65_RS01105 (OHU65_01105) | 195748..196719 | + | 972 | WP_050690798.1 | UV DNA damage repair endonuclease UvsE | - |
| OHU65_RS01110 (OHU65_01110) | 196728..197330 | - | 603 | WP_221786134.1 | rhomboid family intramembrane serine protease | - |
| OHU65_RS01115 (OHU65_01115) | 197395..197760 | + | 366 | WP_264409219.1 | holo-ACP synthase | - |
| OHU65_RS01120 (OHU65_01120) | 197819..198877 | + | 1059 | WP_013055001.1 | outer membrane lipoprotein carrier protein LolA | - |
| OHU65_RS01125 (OHU65_01125) | 198991..200181 | + | 1191 | WP_221786135.1 | alanine racemase | - |
| OHU65_RS01130 (OHU65_01130) | 200383..200664 | + | 282 | WP_013055003.1 | hypothetical protein | Antitoxin |
| OHU65_RS01135 (OHU65_01135) | 200669..201019 | + | 351 | WP_013055004.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
| OHU65_RS01140 (OHU65_01140) | 201177..202013 | + | 837 | WP_013055005.1 | RsbT co-antagonist protein RsbRA | - |
| OHU65_RS01145 (OHU65_01145) | 202016..202372 | + | 357 | WP_013055006.1 | STAS domain-containing protein | - |
| OHU65_RS01150 (OHU65_01150) | 202376..202777 | + | 402 | WP_013055007.1 | anti-sigma regulatory factor | - |
| OHU65_RS01155 (OHU65_01155) | 202809..203801 | + | 993 | WP_223260212.1 | PP2C family protein-serine/threonine phosphatase | - |
| OHU65_RS01160 (OHU65_01160) | 203861..204193 | + | 333 | WP_013055009.1 | anti-sigma factor antagonist | - |
| OHU65_RS01165 (OHU65_01165) | 204190..204675 | + | 486 | WP_025753516.1 | anti-sigma B factor RsbW | - |
| OHU65_RS01170 (OHU65_01170) | 204641..205435 | + | 795 | WP_013055011.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12991.96 Da Isoelectric Point: 4.8781
>T262237 WP_013055004.1 NZ_CP109859:200669-201019 [Priestia megaterium]
MVVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDRVDEALQISVGLIDF
MVVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDRVDEALQISVGLIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|