Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
| Location | 142861..143366 | Replicon | chromosome |
| Accession | NZ_CP109856 | ||
| Organism | Pseudomonas aeruginosa strain PALA53 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | V6A7K8 |
| Locus tag | PALA53_RS00660 | Protein ID | WP_003083773.1 |
| Coordinates | 142861..143142 (-) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | A0A1C7BDS9 |
| Locus tag | PALA53_RS00665 | Protein ID | WP_003083775.1 |
| Coordinates | 143139..143366 (-) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PALA53_RS00635 (PALA53_00125) | 138112..139461 | + | 1350 | WP_003142411.1 | C4-dicarboxylate transporter DctA | - |
| PALA53_RS00640 (PALA53_00126) | 139510..140196 | + | 687 | WP_003083762.1 | FadR/GntR family transcriptional regulator | - |
| PALA53_RS00645 (PALA53_00127) | 140297..141031 | + | 735 | WP_003101224.1 | GntR family transcriptional regulator | - |
| PALA53_RS00650 (PALA53_00128) | 141211..141621 | + | 411 | WP_003101225.1 | aegerolysin family protein | - |
| PALA53_RS00655 (PALA53_00129) | 141653..142561 | - | 909 | WP_016561475.1 | LysR family transcriptional regulator | - |
| PALA53_RS00660 (PALA53_00130) | 142861..143142 | - | 282 | WP_003083773.1 | type II toxin-antitoxin system toxin ParE | Toxin |
| PALA53_RS00665 (PALA53_00131) | 143139..143366 | - | 228 | WP_003083775.1 | CopG family ribbon-helix-helix protein | Antitoxin |
| PALA53_RS00670 (PALA53_00132) | 143542..144162 | - | 621 | WP_003101226.1 | hypothetical protein | - |
| PALA53_RS00675 (PALA53_00133) | 144263..144763 | + | 501 | WP_003101228.1 | LEA type 2 family protein | - |
| PALA53_RS00680 (PALA53_00134) | 144836..145177 | + | 342 | WP_003101229.1 | zinc ribbon domain-containing protein YjdM | - |
| PALA53_RS00685 (PALA53_00135) | 145259..146686 | - | 1428 | WP_003083784.1 | GABA permease | - |
| PALA53_RS00690 (PALA53_00136) | 146855..148348 | - | 1494 | WP_003101230.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10462.19 Da Isoelectric Point: 10.0435
>T262232 WP_003083773.1 NZ_CP109856:c143142-142861 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|