Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 602818..603395 | Replicon | plasmid pESL4.1 |
Accession | NZ_CP109854 | ||
Organism | Pantoea dispersa strain ESL4 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | OH655_RS21900 | Protein ID | WP_215481170.1 |
Coordinates | 603063..603395 (+) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | OH655_RS21895 | Protein ID | WP_215481172.1 |
Coordinates | 602818..603063 (+) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OH655_RS21875 (OH655_21875) | 598181..599134 | + | 954 | WP_153002015.1 | carbohydrate kinase family protein | - |
OH655_RS21880 (OH655_21880) | 599138..600220 | + | 1083 | WP_058776100.1 | sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC | - |
OH655_RS21885 (OH655_21885) | 600339..601748 | - | 1410 | WP_264444192.1 | MFS transporter | - |
OH655_RS21890 (OH655_21890) | 601864..602718 | + | 855 | WP_058770343.1 | helix-turn-helix transcriptional regulator | - |
OH655_RS21895 (OH655_21895) | 602818..603063 | + | 246 | WP_215481172.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
OH655_RS21900 (OH655_21900) | 603063..603395 | + | 333 | WP_215481170.1 | endoribonuclease MazF | Toxin |
OH655_RS21905 (OH655_21905) | 603501..603674 | + | 174 | WP_021508895.1 | hypothetical protein | - |
OH655_RS21910 (OH655_21910) | 603704..604051 | + | 348 | WP_215481169.1 | hypothetical protein | - |
OH655_RS21915 (OH655_21915) | 604091..605284 | - | 1194 | WP_021508893.1 | zinc-dependent alcohol dehydrogenase | - |
OH655_RS21920 (OH655_21920) | 605548..606255 | + | 708 | WP_021508892.1 | phage antirepressor KilAC domain-containing protein | - |
OH655_RS21925 (OH655_21925) | 606290..606505 | - | 216 | WP_021508891.1 | hypothetical protein | - |
OH655_RS21930 (OH655_21930) | 606647..607828 | - | 1182 | WP_058770347.1 | FAD-binding oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | iroN | 1..690879 | 690879 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 12007.87 Da Isoelectric Point: 7.8855
>T262230 WP_215481170.1 NZ_CP109854:603063-603395 [Pantoea dispersa]
MVSRFVPDAGDLIWLDFDPTLGHEQGGHRPAVVLSPFAYNNKVGMLLCVPCTTQVKGYPFEVSLVGSRESVALADQVTSI
DWRARKVVKKSHVTADELSEIRAKAKALIG
MVSRFVPDAGDLIWLDFDPTLGHEQGGHRPAVVLSPFAYNNKVGMLLCVPCTTQVKGYPFEVSLVGSRESVALADQVTSI
DWRARKVVKKSHVTADELSEIRAKAKALIG
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|