Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE(toxin) |
Location | 508006..508708 | Replicon | plasmid pESL4.1 |
Accession | NZ_CP109854 | ||
Organism | Pantoea dispersa strain ESL4 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | OH655_RS21410 | Protein ID | WP_264444068.1 |
Coordinates | 508325..508708 (-) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A246NDH1 |
Locus tag | OH655_RS21405 | Protein ID | WP_058770279.1 |
Coordinates | 508006..508332 (-) | Length | 109 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OH655_RS21385 (OH655_21385) | 503634..504668 | - | 1035 | WP_264444060.1 | aldehyde reductase | - |
OH655_RS21390 (OH655_21390) | 504777..505709 | + | 933 | WP_264444062.1 | AraC family transcriptional regulator | - |
OH655_RS21395 (OH655_21395) | 505737..506771 | - | 1035 | WP_058770277.1 | L-glyceraldehyde 3-phosphate reductase | - |
OH655_RS21400 (OH655_21400) | 506941..507840 | + | 900 | WP_264444064.1 | LysR family transcriptional regulator | - |
OH655_RS21405 (OH655_21405) | 508006..508332 | - | 327 | WP_058770279.1 | helix-turn-helix domain-containing protein | Antitoxin |
OH655_RS21410 (OH655_21410) | 508325..508708 | - | 384 | WP_264444068.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OH655_RS21415 (OH655_21415) | 509013..509303 | + | 291 | WP_021508990.1 | hypothetical protein | - |
OH655_RS21420 (OH655_21420) | 509328..510755 | - | 1428 | WP_264444072.1 | trehalose-6-phosphate synthase | - |
OH655_RS21425 (OH655_21425) | 510928..511791 | - | 864 | WP_264444075.1 | substrate-binding domain-containing protein | - |
OH655_RS21430 (OH655_21430) | 512023..512718 | + | 696 | WP_058775966.1 | hypothetical protein | - |
OH655_RS21435 (OH655_21435) | 512816..513346 | + | 531 | WP_264444078.1 | outer membrane lipoprotein Blc | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | iroN | 1..690879 | 690879 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14083.43 Da Isoelectric Point: 10.2744
>T262228 WP_264444068.1 NZ_CP109854:c508708-508325 [Pantoea dispersa]
MAIYVLKPFDRNFKGDMIADIKLCLAARELIAGQYEASLGGGVYKKRIPLGAGKSGGARAIVAFKSQKHLFFVNGYAKST
TKSGIREIKEDEINFYRQVASQLFAMTTEQERAAIKARKMREVICDG
MAIYVLKPFDRNFKGDMIADIKLCLAARELIAGQYEASLGGGVYKKRIPLGAGKSGGARAIVAFKSQKHLFFVNGYAKST
TKSGIREIKEDEINFYRQVASQLFAMTTEQERAAIKARKMREVICDG
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|