Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 2989828..2990448 Replicon chromosome
Accession NZ_CP109853
Organism Pantoea dispersa strain ESL4

Toxin (Protein)


Gene name Hha Uniprot ID A0A246NIG6
Locus tag OH655_RS13985 Protein ID WP_021507203.1
Coordinates 2990230..2990448 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID A0A246NI99
Locus tag OH655_RS13980 Protein ID WP_021313568.1
Coordinates 2989828..2990205 (+) Length 126 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OH655_RS13950 (OH655_13950) 2986151..2986408 + 258 WP_264441566.1 type B 50S ribosomal protein L31 -
OH655_RS13955 (OH655_13955) 2986424..2986564 + 141 WP_010616859.1 type B 50S ribosomal protein L36 -
OH655_RS13960 (OH655_13960) 2986609..2987487 - 879 WP_058769397.1 metal ABC transporter substrate-binding protein -
OH655_RS13965 (OH655_13965) 2987509..2988348 - 840 WP_058775239.1 metal ABC transporter permease -
OH655_RS13970 (OH655_13970) 2988345..2989001 - 657 WP_021507205.1 ABC transporter ATP-binding protein -
OH655_RS13975 (OH655_13975) 2989329..2989682 + 354 WP_031279656.1 hypothetical protein -
OH655_RS13980 (OH655_13980) 2989828..2990205 + 378 WP_021313568.1 Hha toxicity modulator TomB Antitoxin
OH655_RS13985 (OH655_13985) 2990230..2990448 + 219 WP_021507203.1 HHA domain-containing protein Toxin
OH655_RS13995 (OH655_13995) 2990850..2991161 + 312 WP_021507202.1 MGMT family protein -
OH655_RS14000 (OH655_14000) 2991329..2991886 - 558 WP_021507201.1 YbaY family lipoprotein -
OH655_RS14005 (OH655_14005) 2991902..2992093 + 192 WP_146068777.1 hypothetical protein -
OH655_RS14010 (OH655_14010) 2992090..2992953 + 864 WP_058757950.1 acyl-CoA thioesterase II -
OH655_RS14015 (OH655_14015) 2993026..2994315 - 1290 WP_021507199.1 ammonium transporter AmtB -
OH655_RS14020 (OH655_14020) 2994349..2994687 - 339 WP_007886947.1 P-II family nitrogen regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-114)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8538.87 Da        Isoelectric Point: 8.8662

>T262222 WP_021507203.1 NZ_CP109853:2990230-2990448 [Pantoea dispersa]
MSNPALTKTDYLMRLRRCRSIDTLERVIEKNKYELPDDELAVFYSAADHRLAELTMNKLYDKVPGSVWKYVR

Download         Length: 219 bp

Antitoxin


Download         Length: 126 a.a.        Molecular weight: 14665.34 Da        Isoelectric Point: 4.4796

>AT262222 WP_021313568.1 NZ_CP109853:2989828-2990205 [Pantoea dispersa]
MDEYSPKRHDIAQLKFLCENLFDESMATLTDSHHGWVNDPTSPGNLQLNDLIEHIASFTMNYKIKHVEDEALITQIDEYL
DDTFMLFSSYGINTQDLQRWQRSAKRLFNLFAEECAYLQQPSHSF

Download         Length: 378 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A246NIG6

Antitoxin

Source ID Structure
AlphaFold DB A0A246NI99

References