Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 2989828..2990448 | Replicon | chromosome |
| Accession | NZ_CP109853 | ||
| Organism | Pantoea dispersa strain ESL4 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | A0A246NIG6 |
| Locus tag | OH655_RS13985 | Protein ID | WP_021507203.1 |
| Coordinates | 2990230..2990448 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | A0A246NI99 |
| Locus tag | OH655_RS13980 | Protein ID | WP_021313568.1 |
| Coordinates | 2989828..2990205 (+) | Length | 126 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OH655_RS13950 (OH655_13950) | 2986151..2986408 | + | 258 | WP_264441566.1 | type B 50S ribosomal protein L31 | - |
| OH655_RS13955 (OH655_13955) | 2986424..2986564 | + | 141 | WP_010616859.1 | type B 50S ribosomal protein L36 | - |
| OH655_RS13960 (OH655_13960) | 2986609..2987487 | - | 879 | WP_058769397.1 | metal ABC transporter substrate-binding protein | - |
| OH655_RS13965 (OH655_13965) | 2987509..2988348 | - | 840 | WP_058775239.1 | metal ABC transporter permease | - |
| OH655_RS13970 (OH655_13970) | 2988345..2989001 | - | 657 | WP_021507205.1 | ABC transporter ATP-binding protein | - |
| OH655_RS13975 (OH655_13975) | 2989329..2989682 | + | 354 | WP_031279656.1 | hypothetical protein | - |
| OH655_RS13980 (OH655_13980) | 2989828..2990205 | + | 378 | WP_021313568.1 | Hha toxicity modulator TomB | Antitoxin |
| OH655_RS13985 (OH655_13985) | 2990230..2990448 | + | 219 | WP_021507203.1 | HHA domain-containing protein | Toxin |
| OH655_RS13995 (OH655_13995) | 2990850..2991161 | + | 312 | WP_021507202.1 | MGMT family protein | - |
| OH655_RS14000 (OH655_14000) | 2991329..2991886 | - | 558 | WP_021507201.1 | YbaY family lipoprotein | - |
| OH655_RS14005 (OH655_14005) | 2991902..2992093 | + | 192 | WP_146068777.1 | hypothetical protein | - |
| OH655_RS14010 (OH655_14010) | 2992090..2992953 | + | 864 | WP_058757950.1 | acyl-CoA thioesterase II | - |
| OH655_RS14015 (OH655_14015) | 2993026..2994315 | - | 1290 | WP_021507199.1 | ammonium transporter AmtB | - |
| OH655_RS14020 (OH655_14020) | 2994349..2994687 | - | 339 | WP_007886947.1 | P-II family nitrogen regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8538.87 Da Isoelectric Point: 8.8662
>T262222 WP_021507203.1 NZ_CP109853:2990230-2990448 [Pantoea dispersa]
MSNPALTKTDYLMRLRRCRSIDTLERVIEKNKYELPDDELAVFYSAADHRLAELTMNKLYDKVPGSVWKYVR
MSNPALTKTDYLMRLRRCRSIDTLERVIEKNKYELPDDELAVFYSAADHRLAELTMNKLYDKVPGSVWKYVR
Download Length: 219 bp
Antitoxin
Download Length: 126 a.a. Molecular weight: 14665.34 Da Isoelectric Point: 4.4796
>AT262222 WP_021313568.1 NZ_CP109853:2989828-2990205 [Pantoea dispersa]
MDEYSPKRHDIAQLKFLCENLFDESMATLTDSHHGWVNDPTSPGNLQLNDLIEHIASFTMNYKIKHVEDEALITQIDEYL
DDTFMLFSSYGINTQDLQRWQRSAKRLFNLFAEECAYLQQPSHSF
MDEYSPKRHDIAQLKFLCENLFDESMATLTDSHHGWVNDPTSPGNLQLNDLIEHIASFTMNYKIKHVEDEALITQIDEYL
DDTFMLFSSYGINTQDLQRWQRSAKRLFNLFAEECAYLQQPSHSF
Download Length: 378 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A246NIG6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A246NI99 |