Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 2393943..2394557 | Replicon | chromosome |
| Accession | NZ_CP109853 | ||
| Organism | Pantoea dispersa strain ESL4 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A246NCD7 |
| Locus tag | OH655_RS11040 | Protein ID | WP_058757609.1 |
| Coordinates | 2393943..2394125 (+) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | OH655_RS11045 | Protein ID | WP_022548759.1 |
| Coordinates | 2394165..2394557 (+) | Length | 131 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OH655_RS10990 (OH655_10990) | 2389087..2389749 | + | 663 | WP_021506360.1 | MBL fold metallo-hydrolase | - |
| OH655_RS10995 (OH655_10995) | 2389750..2390163 | - | 414 | WP_058757613.1 | GNAT family N-acetyltransferase | - |
| OH655_RS11000 (OH655_11000) | 2390185..2390568 | - | 384 | WP_021506362.1 | hypothetical protein | - |
| OH655_RS11005 (OH655_11005) | 2390787..2391143 | + | 357 | WP_010617204.1 | DUF4186 domain-containing protein | - |
| OH655_RS11010 (OH655_11010) | 2391162..2391341 | - | 180 | WP_031279245.1 | hypothetical protein | - |
| OH655_RS11015 (OH655_11015) | 2391545..2391874 | + | 330 | WP_264441367.1 | hypothetical protein | - |
| OH655_RS11020 (OH655_11020) | 2391936..2392484 | + | 549 | WP_264441368.1 | hypothetical protein | - |
| OH655_RS11025 (OH655_11025) | 2392509..2392715 | - | 207 | WP_058769647.1 | DUF2767 family protein | - |
| OH655_RS11030 (OH655_11030) | 2392896..2393144 | + | 249 | WP_021506368.1 | DUF883 family protein | - |
| OH655_RS11035 (OH655_11035) | 2393477..2393674 | - | 198 | WP_021506369.1 | DUF6404 family protein | - |
| OH655_RS11040 (OH655_11040) | 2393943..2394125 | + | 183 | WP_058757609.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| OH655_RS11045 (OH655_11045) | 2394165..2394557 | + | 393 | WP_022548759.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| OH655_RS11050 (OH655_11050) | 2394642..2395898 | + | 1257 | WP_264441371.1 | mechanosensitive ion channel family protein | - |
| OH655_RS11055 (OH655_11055) | 2396020..2397270 | - | 1251 | WP_010617214.1 | NADP-dependent isocitrate dehydrogenase | - |
| OH655_RS11060 (OH655_11060) | 2397372..2398040 | + | 669 | WP_150058306.1 | 23S rRNA pseudouridine(2457) synthase RluE | - |
| OH655_RS11065 (OH655_11065) | 2398085..2398558 | + | 474 | WP_031279253.1 | NUDIX hydrolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6958.19 Da Isoelectric Point: 10.9062
>T262221 WP_058757609.1 NZ_CP109853:2393943-2394125 [Pantoea dispersa]
MKSATLIKLLQKNGWKLERIRGSHHQFSHPDFAHLITVPHPQKDMKTGTLMQILKDARLD
MKSATLIKLLQKNGWKLERIRGSHHQFSHPDFAHLITVPHPQKDMKTGTLMQILKDARLD
Download Length: 183 bp
Antitoxin
Download Length: 131 a.a. Molecular weight: 14554.49 Da Isoelectric Point: 4.8732
>AT262221 WP_022548759.1 NZ_CP109853:2394165-2394557 [Pantoea dispersa]
MLFPALVEIDADGSASGYFPDVTGCYFAGDTPEQTLQDAQSALHAHFELMAEKGLLIPEPAQHWQQEFSQPGVWIYVDID
VTRYLGKSERINITMPHLLIEKIDKMVSNNARYSSRSHFLAEAARKALVS
MLFPALVEIDADGSASGYFPDVTGCYFAGDTPEQTLQDAQSALHAHFELMAEKGLLIPEPAQHWQQEFSQPGVWIYVDID
VTRYLGKSERINITMPHLLIEKIDKMVSNNARYSSRSHFLAEAARKALVS
Download Length: 393 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|