Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1575606..1576223 | Replicon | chromosome |
| Accession | NZ_CP109853 | ||
| Organism | Pantoea dispersa strain ESL4 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | OH655_RS07055 | Protein ID | WP_141495245.1 |
| Coordinates | 1575606..1575794 (+) | Length | 63 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | OH655_RS07060 | Protein ID | WP_058781997.1 |
| Coordinates | 1575813..1576223 (+) | Length | 137 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OH655_RS07040 (OH655_07040) | 1572496..1573281 | - | 786 | WP_245001405.1 | PhnD/SsuA/transferrin family substrate-binding protein | - |
| OH655_RS07045 (OH655_07045) | 1573178..1574245 | - | 1068 | WP_264443640.1 | fatty acid desaturase | - |
| OH655_RS07050 (OH655_07050) | 1574463..1575485 | + | 1023 | WP_021509376.1 | LLM class flavin-dependent oxidoreductase | - |
| OH655_RS07055 (OH655_07055) | 1575606..1575794 | + | 189 | WP_141495245.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| OH655_RS07060 (OH655_07060) | 1575813..1576223 | + | 411 | WP_058781997.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| OH655_RS07065 (OH655_07065) | 1576717..1577544 | - | 828 | WP_058771104.1 | glycosyltransferase family 8 protein | - |
| OH655_RS07070 (OH655_07070) | 1577573..1578955 | - | 1383 | WP_264442901.1 | D-arabinono-1,4-lactone oxidase | - |
| OH655_RS07075 (OH655_07075) | 1579034..1579675 | - | 642 | WP_021509768.1 | TetR family transcriptional regulator | - |
| OH655_RS07080 (OH655_07080) | 1579888..1580715 | + | 828 | WP_264442907.1 | MetQ/NlpA family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 63 a.a. Molecular weight: 7000.25 Da Isoelectric Point: 11.0007
>T262220 WP_141495245.1 NZ_CP109853:1575606-1575794 [Pantoea dispersa]
MDSRSLMAEIKADGWELIRINGSHHHFVHPTKKGLVTIPHPKKDLPIKTVKSIRKQAGLTVH
MDSRSLMAEIKADGWELIRINGSHHHFVHPTKKGLVTIPHPKKDLPIKTVKSIRKQAGLTVH
Download Length: 189 bp
Antitoxin
Download Length: 137 a.a. Molecular weight: 14780.06 Da Isoelectric Point: 4.6268
>AT262220 WP_058781997.1 NZ_CP109853:1575813-1576223 [Pantoea dispersa]
MFYPIAIEAGDETTAYGVTVPDLPGCFSAGDTLEEAVKNAKEAITGHLELMVELGQDIPAVSDLKSLMKSAEFAGYVWVL
VDVDVTRILGGSEKINVTLPKLLIDRIDRCVATHPEFKTRSGFLAQVALERIAKTR
MFYPIAIEAGDETTAYGVTVPDLPGCFSAGDTLEEAVKNAKEAITGHLELMVELGQDIPAVSDLKSLMKSAEFAGYVWVL
VDVDVTRILGGSEKINVTLPKLLIDRIDRCVATHPEFKTRSGFLAQVALERIAKTR
Download Length: 411 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|