Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PfiT-PfiA/ParE(toxin) |
Location | 4823011..4823619 | Replicon | chromosome |
Accession | NZ_CP109851 | ||
Organism | Pseudomonas aeruginosa strain PALA51 |
Toxin (Protein)
Gene name | PfiT | Uniprot ID | A0A444LUU5 |
Locus tag | PALA51_RS22750 | Protein ID | WP_019486378.1 |
Coordinates | 4823011..4823358 (-) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | PfiA | Uniprot ID | A0A0B0C355 |
Locus tag | PALA51_RS22755 | Protein ID | WP_003114155.1 |
Coordinates | 4823368..4823619 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PALA51_RS22720 (PALA51_04510) | 4818370..4818642 | + | 273 | WP_073651557.1 | cysteine-rich CWC family protein | - |
PALA51_RS22725 (PALA51_04511) | 4818642..4819334 | + | 693 | WP_003116517.1 | 16S rRNA pseudouridine(516) synthase | - |
PALA51_RS22730 (PALA51_04512) | 4819470..4820513 | + | 1044 | WP_003110811.1 | L,D-transpeptidase | - |
PALA51_RS22735 (PALA51_04513) | 4820593..4821330 | + | 738 | WP_003085453.1 | murein L,D-transpeptidase catalytic domain family protein | - |
PALA51_RS22740 (PALA51_04514) | 4821782..4822684 | + | 903 | WP_003116518.1 | (R)-3-hydroxydecanoyl-ACP:CoA transacylase | - |
PALA51_RS22750 (PALA51_04516) | 4823011..4823358 | - | 348 | WP_019486378.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PALA51_RS22755 | 4823368..4823619 | - | 252 | WP_003114155.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
PALA51_RS22760 (PALA51_04517) | 4823833..4824816 | - | 984 | WP_121382283.1 | tyrosine-type recombinase/integrase | - |
PALA51_RS22765 (PALA51_04518) | 4824816..4826108 | - | 1293 | WP_269972208.1 | hypothetical protein | - |
PALA51_RS22770 (PALA51_04520) | 4826338..4827621 | - | 1284 | WP_023122801.1 | zonular occludens toxin family protein | - |
PALA51_RS22775 (PALA51_04521) | 4827625..4827981 | - | 357 | WP_003114150.1 | DUF2523 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 4823011..4838622 | 15611 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 12956.72 Da Isoelectric Point: 4.4212
>T262217 WP_019486378.1 NZ_CP109851:c4823358-4823011 [Pseudomonas aeruginosa]
MSPVVIRFTDTAEQSIEDQVHHLAPFQGEQAALQSVLSLLDEIEEKISLAPKGYPVSQQASLLGVLSYRELNTGPYRVFY
EFHEEQGEAAVILVLRQKQSVEQQLIRYCLVGPIE
MSPVVIRFTDTAEQSIEDQVHHLAPFQGEQAALQSVLSLLDEIEEKISLAPKGYPVSQQASLLGVLSYRELNTGPYRVFY
EFHEEQGEAAVILVLRQKQSVEQQLIRYCLVGPIE
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A444LUU5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0B0C355 |