Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PfiT-PfiA/ParE(toxin) |
Location | 4014866..4015474 | Replicon | chromosome |
Accession | NZ_CP109850 | ||
Organism | Pseudomonas aeruginosa strain PALA37 |
Toxin (Protein)
Gene name | PfiT | Uniprot ID | - |
Locus tag | PALA37_RS18645 | Protein ID | WP_016263850.1 |
Coordinates | 4015127..4015474 (+) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | PfiA | Uniprot ID | A0A0B0C355 |
Locus tag | PALA37_RS18640 | Protein ID | WP_003114155.1 |
Coordinates | 4014866..4015117 (+) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PALA37_RS18620 (PALA37_03686) | 4010504..4010854 | + | 351 | WP_003159569.1 | DUF2523 family protein | - |
PALA37_RS18625 (PALA37_03687) | 4010856..4012118 | + | 1263 | WP_124131951.1 | zonular occludens toxin domain-containing protein | - |
PALA37_RS18630 (PALA37_03689) | 4012377..4013669 | + | 1293 | WP_270132557.1 | hypothetical protein | - |
PALA37_RS18635 (PALA37_03690) | 4013669..4014652 | + | 984 | WP_003114154.1 | tyrosine-type recombinase/integrase | - |
PALA37_RS18640 | 4014866..4015117 | + | 252 | WP_003114155.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
PALA37_RS18645 (PALA37_03691) | 4015127..4015474 | + | 348 | WP_016263850.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PALA37_RS18655 (PALA37_03693) | 4015801..4016703 | - | 903 | WP_003085447.1 | (R)-3-hydroxydecanoyl-ACP:CoA transacylase | - |
PALA37_RS18660 (PALA37_03694) | 4017155..4017892 | - | 738 | WP_023127195.1 | murein L,D-transpeptidase catalytic domain family protein | - |
PALA37_RS18665 (PALA37_03695) | 4017972..4019015 | - | 1044 | WP_003134392.1 | L,D-transpeptidase | - |
PALA37_RS18670 (PALA37_03696) | 4019151..4019843 | - | 693 | WP_003085458.1 | 16S rRNA pseudouridine(516) synthase | - |
PALA37_RS18675 (PALA37_03697) | 4019843..4020115 | - | 273 | WP_021264275.1 | cysteine-rich CWC family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 3990223..4015474 | 25251 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13046.85 Da Isoelectric Point: 4.4212
>T262209 WP_016263850.1 NZ_CP109850:4015127-4015474 [Pseudomonas aeruginosa]
MSPVVIRFTDTAEQSIEDQVHHLVPFQGEQAAFQSVLSLLDEIEEKISLAPKGYPVSQQASLLGVLSYRELNTGPYRVFY
EFHEEQGEVAVILVLRQKQSVEQQLIRYCLVGPIE
MSPVVIRFTDTAEQSIEDQVHHLVPFQGEQAAFQSVLSLLDEIEEKISLAPKGYPVSQQASLLGVLSYRELNTGPYRVFY
EFHEEQGEVAVILVLRQKQSVEQQLIRYCLVGPIE
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|