Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PfiT-PfiA/ParE(toxin) |
Location | 5330238..5330846 | Replicon | chromosome |
Accession | NZ_CP109849 | ||
Organism | Pseudomonas aeruginosa strain PALA34 |
Toxin (Protein)
Gene name | PfiT | Uniprot ID | A0A1B1XUZ2 |
Locus tag | PALA34_RS25070 | Protein ID | WP_003123043.1 |
Coordinates | 5330238..5330585 (-) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | PfiA | Uniprot ID | A0A0B0C355 |
Locus tag | PALA34_RS25075 | Protein ID | WP_003114155.1 |
Coordinates | 5330595..5330846 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PALA34_RS25040 (PALA34_04951) | 5325597..5325869 | + | 273 | WP_016851967.1 | cysteine-rich CWC family protein | - |
PALA34_RS25045 (PALA34_04952) | 5325869..5326561 | + | 693 | WP_016851968.1 | 16S rRNA pseudouridine(516) synthase | - |
PALA34_RS25050 (PALA34_04953) | 5326697..5327740 | + | 1044 | WP_003098363.1 | L,D-transpeptidase | - |
PALA34_RS25055 (PALA34_04954) | 5327820..5328557 | + | 738 | WP_003085453.1 | murein L,D-transpeptidase catalytic domain family protein | - |
PALA34_RS25060 (PALA34_04955) | 5329009..5329911 | + | 903 | WP_014603238.1 | (R)-3-hydroxydecanoyl-ACP:CoA transacylase | - |
PALA34_RS25070 (PALA34_04957) | 5330238..5330585 | - | 348 | WP_003123043.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PALA34_RS25075 | 5330595..5330846 | - | 252 | WP_003114155.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
PALA34_RS25080 (PALA34_04958) | 5331060..5332043 | - | 984 | WP_016852062.1 | tyrosine-type recombinase/integrase | - |
PALA34_RS25085 (PALA34_04959) | 5332043..5333335 | - | 1293 | WP_003115206.1 | hypothetical protein | - |
PALA34_RS25090 (PALA34_04961) | 5333594..5334856 | - | 1263 | WP_023093179.1 | zonular occludens toxin domain-containing protein | - |
PALA34_RS25095 (PALA34_04962) | 5334858..5335208 | - | 351 | WP_003159569.1 | DUF2523 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | catB7 | - | 5330238..5352079 | 21841 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 12990.74 Da Isoelectric Point: 4.4212
>T262203 WP_003123043.1 NZ_CP109849:c5330585-5330238 [Pseudomonas aeruginosa]
MSPVVIRFTDTAEQSIEDQVHHLAPFQGEQAAFQSVLSLLDEIEEKISLAPKGYPVSQQASLLGVLSYRELNTGPYRVFY
EFHEEQGEAAVILVLRQKQSVEQQLIRYCLVGPIE
MSPVVIRFTDTAEQSIEDQVHHLAPFQGEQAAFQSVLSLLDEIEEKISLAPKGYPVSQQASLLGVLSYRELNTGPYRVFY
EFHEEQGEAAVILVLRQKQSVEQQLIRYCLVGPIE
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1B1XUZ2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0B0C355 |