Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
Location | 4942145..4942731 | Replicon | chromosome |
Accession | NZ_CP109849 | ||
Organism | Pseudomonas aeruginosa strain PALA34 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | G8CP73 |
Locus tag | PALA34_RS23120 | Protein ID | WP_003120987.1 |
Coordinates | 4942432..4942731 (-) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | - |
Locus tag | PALA34_RS23115 | Protein ID | WP_003448662.1 |
Coordinates | 4942145..4942435 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PALA34_RS23095 (PALA34_04567) | 4937296..4937505 | + | 210 | WP_003105733.1 | cold-shock protein | - |
PALA34_RS23100 (PALA34_04568) | 4937727..4939616 | + | 1890 | WP_016851610.1 | hypothetical protein | - |
PALA34_RS23105 (PALA34_04569) | 4939613..4941589 | + | 1977 | WP_016851611.1 | DEAD/DEAH box helicase | - |
PALA34_RS23110 | 4941730..4942074 | + | 345 | WP_016851612.1 | hypothetical protein | - |
PALA34_RS23115 (PALA34_04570) | 4942145..4942435 | - | 291 | WP_003448662.1 | putative addiction module antidote protein | Antitoxin |
PALA34_RS23120 (PALA34_04571) | 4942432..4942731 | - | 300 | WP_003120987.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PALA34_RS23125 (PALA34_04572) | 4942933..4944057 | + | 1125 | WP_012076859.1 | TcpQ domain-containing protein | - |
PALA34_RS23130 (PALA34_04573) | 4944057..4945766 | + | 1710 | WP_012076860.1 | PilN family type IVB pilus formation outer membrane protein | - |
PALA34_RS23135 (PALA34_04574) | 4945770..4947095 | + | 1326 | WP_003099758.1 | type 4b pilus protein PilO2 | - |
PALA34_RS23140 (PALA34_04575) | 4947085..4947618 | + | 534 | WP_003099760.1 | type IV pilus biogenesis protein PilP | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 4916021..5018002 | 101981 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11133.88 Da Isoelectric Point: 10.4495
>T262202 WP_003120987.1 NZ_CP109849:c4942731-4942432 [Pseudomonas aeruginosa]
MVEVKQTATFMAWESKLKDRRAKAVIAARIFRLANGLPGDVSPVGQGVSELRIHYGPGYRVYFQQRGTEIVILLCGGDKS
SQARDIEMAKRLANEWRPQ
MVEVKQTATFMAWESKLKDRRAKAVIAARIFRLANGLPGDVSPVGQGVSELRIHYGPGYRVYFQQRGTEIVILLCGGDKS
SQARDIEMAKRLANEWRPQ
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|