Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
Location | 148743..149248 | Replicon | chromosome |
Accession | NZ_CP109849 | ||
Organism | Pseudomonas aeruginosa strain PALA34 |
Toxin (Protein)
Gene name | parE | Uniprot ID | A0A069QL22 |
Locus tag | PALA34_RS00670 | Protein ID | WP_003121619.1 |
Coordinates | 148743..149024 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | Q9I707 |
Locus tag | PALA34_RS00675 | Protein ID | WP_003112628.1 |
Coordinates | 149021..149248 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PALA34_RS00645 (PALA34_00127) | 143994..145343 | + | 1350 | WP_003119513.1 | C4-dicarboxylate transporter DctA | - |
PALA34_RS00650 (PALA34_00128) | 145392..146078 | + | 687 | WP_003083762.1 | FadR/GntR family transcriptional regulator | - |
PALA34_RS00655 (PALA34_00129) | 146179..146913 | + | 735 | WP_003117208.1 | GntR family transcriptional regulator | - |
PALA34_RS00660 (PALA34_00130) | 147093..147503 | + | 411 | WP_003101225.1 | aegerolysin family protein | - |
PALA34_RS00665 (PALA34_00131) | 147535..148443 | - | 909 | WP_016561475.1 | LysR family transcriptional regulator | - |
PALA34_RS00670 (PALA34_00132) | 148743..149024 | - | 282 | WP_003121619.1 | type II toxin-antitoxin system toxin ParE | Toxin |
PALA34_RS00675 (PALA34_00133) | 149021..149248 | - | 228 | WP_003112628.1 | CopG family ribbon-helix-helix protein | Antitoxin |
PALA34_RS00680 (PALA34_00134) | 149424..150044 | - | 621 | WP_003101226.1 | hypothetical protein | - |
PALA34_RS00685 (PALA34_00135) | 150145..150645 | + | 501 | WP_003112629.1 | LEA type 2 family protein | - |
PALA34_RS00690 (PALA34_00136) | 150718..151059 | + | 342 | WP_003101229.1 | zinc ribbon domain-containing protein YjdM | - |
PALA34_RS00695 (PALA34_00137) | 151141..152568 | - | 1428 | WP_003083784.1 | GABA permease | - |
PALA34_RS00700 (PALA34_00138) | 152737..154230 | - | 1494 | WP_003083788.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10492.22 Da Isoelectric Point: 10.0435
>T262198 WP_003121619.1 NZ_CP109849:c149024-148743 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDTIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
MSLKWTRKAAADLDTIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A069QL22 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 6XRW | |
AlphaFold DB | Q9I707 |