Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hipBA/HipA-HipB |
Location | 4574029..4575039 | Replicon | chromosome |
Accession | NZ_CP109846 | ||
Organism | Providencia rettgeri strain 12105 isolate P12105 |
Toxin (Protein)
Gene name | hipA | Uniprot ID | - |
Locus tag | NTP67_RS21340 | Protein ID | WP_225833099.1 |
Coordinates | 4574029..4574742 (-) | Length | 238 a.a. |
Antitoxin (Protein)
Gene name | hipB | Uniprot ID | - |
Locus tag | NTP67_RS21345 | Protein ID | WP_264403986.1 |
Coordinates | 4574782..4575039 (-) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NTP67_RS21330 (NTP67_21330) | 4569978..4573025 | - | 3048 | WP_282551101.1 | formate dehydrogenase-N subunit alpha | - |
NTP67_RS21335 (NTP67_21335) | 4573202..4574032 | + | 831 | WP_166686683.1 | formate dehydrogenase accessory sulfurtransferase FdhD | - |
NTP67_RS21340 (NTP67_21340) | 4574029..4574742 | - | 714 | WP_225833099.1 | HipA domain-containing protein | Toxin |
NTP67_RS21345 (NTP67_21345) | 4574782..4575039 | - | 258 | WP_264403986.1 | helix-turn-helix domain-containing protein | Antitoxin |
NTP67_RS21350 (NTP67_21350) | 4575195..4575959 | - | 765 | WP_042846773.1 | hypothetical protein | - |
NTP67_RS21355 (NTP67_21355) | 4576090..4577454 | - | 1365 | WP_042846829.1 | tRNA uridine-5-carboxymethylaminomethyl(34) synthesis GTPase MnmE | - |
NTP67_RS21360 (NTP67_21360) | 4577582..4579231 | - | 1650 | WP_042846774.1 | membrane protein insertase YidC | - |
NTP67_RS21365 (NTP67_21365) | 4579234..4579494 | - | 261 | WP_042846775.1 | membrane protein insertion efficiency factor YidD | - |
NTP67_RS21370 (NTP67_21370) | 4579458..4579817 | - | 360 | WP_072035181.1 | ribonuclease P protein component | - |
NTP67_RS21375 (NTP67_21375) | 4579839..4579982 | - | 144 | WP_042846776.1 | 50S ribosomal protein L34 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 238 a.a. Molecular weight: 27212.28 Da Isoelectric Point: 8.0790
>T262197 WP_225833099.1 NZ_CP109846:c4574742-4574029 [Providencia rettgeri]
VTLFAQVLGLISLNDVPHSFILNVGEIKALAVERFERKYSSDSSWIMRLPQEDFCQTLNISPARKYQNHGGPGISEIMNY
LLGSINAEKDRYQFMKSQVLFWLLAATDGHAKNFSLFIEPEGRYQLTPFYDILSMYPSYGGRGINPRDAKLAMGLKGTRE
MKYNIEQIFPRHFFATAKEVGFDRTEMEKILIEFDEQMESVITKVREQLPTNFPKHIADSILSGLHHKAARLKKGWD
VTLFAQVLGLISLNDVPHSFILNVGEIKALAVERFERKYSSDSSWIMRLPQEDFCQTLNISPARKYQNHGGPGISEIMNY
LLGSINAEKDRYQFMKSQVLFWLLAATDGHAKNFSLFIEPEGRYQLTPFYDILSMYPSYGGRGINPRDAKLAMGLKGTRE
MKYNIEQIFPRHFFATAKEVGFDRTEMEKILIEFDEQMESVITKVREQLPTNFPKHIADSILSGLHHKAARLKKGWD
Download Length: 714 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|