Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 3071455..3071963 | Replicon | chromosome |
Accession | NZ_CP109846 | ||
Organism | Providencia rettgeri strain 12105 isolate P12105 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | - |
Locus tag | NTP67_RS14090 | Protein ID | WP_129465771.1 |
Coordinates | 3071655..3071963 (+) | Length | 103 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | - |
Locus tag | NTP67_RS14085 | Protein ID | WP_238563506.1 |
Coordinates | 3071455..3071655 (+) | Length | 67 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NTP67_RS14065 (NTP67_14065) | 3066884..3067186 | + | 303 | WP_042844270.1 | flagellar biosynthesis anti-sigma factor FlgM | - |
NTP67_RS14070 (NTP67_14070) | 3067196..3067636 | + | 441 | WP_042844271.1 | flagellar export chaperone FlgN | - |
NTP67_RS14075 (NTP67_14075) | 3068007..3070106 | - | 2100 | WP_042844272.1 | flagellar biosynthesis protein FlhA | - |
NTP67_RS14080 (NTP67_14080) | 3070099..3071250 | - | 1152 | WP_042844273.1 | flagellar biosynthesis protein FlhB | - |
NTP67_RS14085 (NTP67_14085) | 3071455..3071655 | + | 201 | WP_238563506.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
NTP67_RS14090 (NTP67_14090) | 3071655..3071963 | + | 309 | WP_129465771.1 | CcdB family protein | Toxin |
NTP67_RS14095 (NTP67_14095) | 3071979..3072536 | + | 558 | WP_129465770.1 | hypothetical protein | - |
NTP67_RS14100 (NTP67_14100) | 3072557..3072856 | - | 300 | WP_042844276.1 | helix-turn-helix transcriptional regulator | - |
NTP67_RS14105 (NTP67_14105) | 3073073..3073711 | - | 639 | WP_042844277.1 | protein phosphatase CheZ | - |
NTP67_RS14110 (NTP67_14110) | 3073736..3074128 | - | 393 | WP_034782834.1 | chemotaxis response regulator CheY | - |
NTP67_RS14115 (NTP67_14115) | 3074168..3075235 | - | 1068 | WP_042844278.1 | chemotaxis response regulator protein-glutamate methylesterase | - |
NTP67_RS14120 (NTP67_14120) | 3075235..3076071 | - | 837 | WP_042844279.1 | CheR family methyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11649.69 Da Isoelectric Point: 6.4602
>T262196 WP_129465771.1 NZ_CP109846:3071655-3071963 [Providencia rettgeri]
MQYCLYQNREDTVKHPYLLDIQSNIIDILNTLLVIPLFDSRLAKKPLPTCLNPQLFSNGQVFVLMTHQMACVPHSLLGKE
IVDLNCQQNTIKHAIDLLIDGF
MQYCLYQNREDTVKHPYLLDIQSNIIDILNTLLVIPLFDSRLAKKPLPTCLNPQLFSNGQVFVLMTHQMACVPHSLLGKE
IVDLNCQQNTIKHAIDLLIDGF
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|