Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 1597426..1598083 | Replicon | chromosome |
| Accession | NZ_CP109846 | ||
| Organism | Providencia rettgeri strain 12105 isolate P12105 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A1J0E9L4 |
| Locus tag | NTP67_RS07075 | Protein ID | WP_042845040.1 |
| Coordinates | 1597673..1598083 (+) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | A0A1J0E9J6 |
| Locus tag | NTP67_RS07070 | Protein ID | WP_042845042.1 |
| Coordinates | 1597426..1597692 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NTP67_RS07055 (NTP67_07055) | 1594504..1595394 | - | 891 | WP_226693718.1 | hypothetical protein | - |
| NTP67_RS07060 (NTP67_07060) | 1595555..1596175 | - | 621 | WP_042845046.1 | HD domain-containing protein | - |
| NTP67_RS07065 (NTP67_07065) | 1596187..1597176 | - | 990 | WP_129466207.1 | tRNA-modifying protein YgfZ | - |
| NTP67_RS07070 (NTP67_07070) | 1597426..1597692 | + | 267 | WP_042845042.1 | FAD assembly factor SdhE | Antitoxin |
| NTP67_RS07075 (NTP67_07075) | 1597673..1598083 | + | 411 | WP_042845040.1 | protein YgfX | Toxin |
| NTP67_RS07080 (NTP67_07080) | 1598137..1598655 | - | 519 | WP_042845038.1 | flavodoxin FldB | - |
| NTP67_RS07085 (NTP67_07085) | 1598773..1599675 | + | 903 | WP_129466206.1 | site-specific tyrosine recombinase XerD | - |
| NTP67_RS07090 (NTP67_07090) | 1599697..1600401 | + | 705 | WP_264403667.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| NTP67_RS07095 (NTP67_07095) | 1600411..1602144 | + | 1734 | WP_264403668.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 15461.25 Da Isoelectric Point: 10.6538
>T262194 WP_042845040.1 NZ_CP109846:1597673-1598083 [Providencia rettgeri]
VVLWKSNLSISWKTQFFSTCVHGAVGMFLLVAPWAPAHSMIWLPLLAVVVASWAKSQKNISKIKGVAVLVNGNKVQWKKN
EWNIVKAPWLSRYGILLSLEALQGKQQKIHLWVAKDSVSEESWRNLNQLLLQYPDI
VVLWKSNLSISWKTQFFSTCVHGAVGMFLLVAPWAPAHSMIWLPLLAVVVASWAKSQKNISKIKGVAVLVNGNKVQWKKN
EWNIVKAPWLSRYGILLSLEALQGKQQKIHLWVAKDSVSEESWRNLNQLLLQYPDI
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1J0E9L4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1J0E9J6 |