Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 934240..934886 | Replicon | chromosome |
| Accession | NZ_CP109846 | ||
| Organism | Providencia rettgeri strain 12105 isolate P12105 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | A0A1J0E3F0 |
| Locus tag | NTP67_RS04155 | Protein ID | WP_042846891.1 |
| Coordinates | 934240..934443 (-) | Length | 68 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | A0A1J0E3I4 |
| Locus tag | NTP67_RS04160 | Protein ID | WP_042846890.1 |
| Coordinates | 934518..934886 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NTP67_RS04130 (NTP67_04130) | 930319..930657 | + | 339 | WP_042846895.1 | P-II family nitrogen regulator | - |
| NTP67_RS04135 (NTP67_04135) | 930707..931951 | + | 1245 | WP_230233526.1 | ammonium transporter AmtB | - |
| NTP67_RS04140 (NTP67_04140) | 932092..932958 | - | 867 | WP_042846893.1 | acyl-CoA thioesterase II | - |
| NTP67_RS04145 (NTP67_04145) | 933198..933656 | + | 459 | WP_042846892.1 | YbaY family lipoprotein | - |
| NTP67_RS04155 (NTP67_04155) | 934240..934443 | - | 204 | WP_042846891.1 | HHA domain-containing protein | Toxin |
| NTP67_RS04160 (NTP67_04160) | 934518..934886 | - | 369 | WP_042846890.1 | Hha toxicity modulator TomB | Antitoxin |
| NTP67_RS04165 (NTP67_04165) | 935416..936786 | - | 1371 | WP_048608373.1 | murein transglycosylase D | - |
| NTP67_RS04170 (NTP67_04170) | 936868..937620 | - | 753 | WP_042846888.1 | hydroxyacylglutathione hydrolase | - |
| NTP67_RS04175 (NTP67_04175) | 937654..938388 | + | 735 | WP_042846887.1 | methyltransferase domain-containing protein | - |
| NTP67_RS04180 (NTP67_04180) | 938385..938855 | - | 471 | WP_042846886.1 | ribonuclease HI | - |
| NTP67_RS04185 (NTP67_04185) | 938910..939671 | + | 762 | WP_042846885.1 | DNA polymerase III subunit epsilon | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 68 a.a. Molecular weight: 8087.38 Da Isoelectric Point: 6.9770
>T262193 WP_042846891.1 NZ_CP109846:c934443-934240 [Providencia rettgeri]
MTKSDYLMRLRKCTTIETLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPPSVWKFVR
MTKSDYLMRLRKCTTIETLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPPSVWKFVR
Download Length: 204 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 14123.05 Da Isoelectric Point: 4.3849
>AT262193 WP_042846890.1 NZ_CP109846:c934886-934518 [Providencia rettgeri]
MDEYSPKRHDIAELKYLCNSLNRDAILSLQKTNTHWINDLSSAQSAALNELIEHIAAFVWRFKIKYPKENLVISLIEEYL
DETYDLFGSPVITLSEIIDWETMNQNLVSVLDDDLKCLTSKT
MDEYSPKRHDIAELKYLCNSLNRDAILSLQKTNTHWINDLSSAQSAALNELIEHIAAFVWRFKIKYPKENLVISLIEEYL
DETYDLFGSPVITLSEIIDWETMNQNLVSVLDDDLKCLTSKT
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1J0E3F0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1J0E3I4 |