Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PP_4151-4152/excise(antitoxin) |
Location | 2872035..2873077 | Replicon | chromosome |
Accession | NZ_CP109845 | ||
Organism | Pseudomonas aeruginosa strain PALA33 |
Toxin (Protein)
Gene name | PP_4152 | Uniprot ID | - |
Locus tag | PALA33_RS13650 | Protein ID | WP_003050248.1 |
Coordinates | 2872502..2873077 (+) | Length | 192 a.a. |
Antitoxin (Protein)
Gene name | PP_4151 | Uniprot ID | I3TV68 |
Locus tag | PALA33_RS13645 | Protein ID | WP_003050245.1 |
Coordinates | 2872035..2872505 (+) | Length | 157 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PALA33_RS13610 (PALA33_02690) | 2867426..2868844 | - | 1419 | WP_023087297.1 | TIGR03752 family integrating conjugative element protein | - |
PALA33_RS13615 (PALA33_02691) | 2868834..2869745 | - | 912 | WP_023087298.1 | TIGR03749 family integrating conjugative element protein | - |
PALA33_RS13620 (PALA33_02692) | 2869742..2870434 | - | 693 | WP_023087299.1 | TIGR03746 family integrating conjugative element protein | - |
PALA33_RS13625 (PALA33_02693) | 2870431..2870829 | - | 399 | WP_003105639.1 | TIGR03750 family conjugal transfer protein | - |
PALA33_RS13630 (PALA33_02694) | 2870842..2871201 | - | 360 | WP_021195311.1 | TIGR03745 family integrating conjugative element membrane protein | - |
PALA33_RS13635 (PALA33_02695) | 2871218..2871451 | - | 234 | WP_003050225.1 | TIGR03758 family integrating conjugative element protein | - |
PALA33_RS13640 (PALA33_02696) | 2871448..2871831 | - | 384 | WP_023087300.1 | RAQPRD family integrative conjugative element protein | - |
PALA33_RS13645 (PALA33_02697) | 2872035..2872505 | + | 471 | WP_003050245.1 | helix-turn-helix domain-containing protein | Antitoxin |
PALA33_RS13650 (PALA33_02698) | 2872502..2873077 | + | 576 | WP_003050248.1 | PIN domain-containing protein | Toxin |
PALA33_RS13655 (PALA33_02699) | 2873095..2874009 | + | 915 | WP_023087301.1 | AAA family ATPase | - |
PALA33_RS13660 (PALA33_02700) | 2874006..2874476 | + | 471 | WP_023087302.1 | type III CBASS phage resistance system CD-NTase-associated protein Cap8 | - |
PALA33_RS13665 (PALA33_02701) | 2874473..2874973 | + | 501 | WP_003050262.1 | type III CBASS phage resistance system CD-NTase-associated protein Cap7 | - |
PALA33_RS13670 (PALA33_02702) | 2874973..2875875 | + | 903 | WP_023087303.1 | CBASS oligonucleotide cyclase | - |
PALA33_RS13675 (PALA33_02703) | 2875912..2876637 | + | 726 | WP_023087304.1 | CBASS effector endonuclease NucC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 2803349..2918565 | 115216 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 192 a.a. Molecular weight: 21630.76 Da Isoelectric Point: 5.6130
>T262189 WP_003050248.1 NZ_CP109845:2872502-2873077 [Pseudomonas aeruginosa]
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPDDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIDVDRYLEILLRQGLVQTTKVLATYRTIL
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPDDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIDVDRYLEILLRQGLVQTTKVLATYRTIL
Download Length: 576 bp
Antitoxin
Download Length: 157 a.a. Molecular weight: 17245.62 Da Isoelectric Point: 6.3803
>AT262189 WP_003050245.1 NZ_CP109845:2872035-2872505 [Pseudomonas aeruginosa]
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE
Download Length: 471 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|