Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
| Location | 191047..191552 | Replicon | chromosome |
| Accession | NZ_CP109845 | ||
| Organism | Pseudomonas aeruginosa strain PALA33 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | A0A7M2ZNP4 |
| Locus tag | PALA33_RS00885 | Protein ID | WP_009875660.1 |
| Coordinates | 191047..191328 (-) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | A0A0H2ZJU8 |
| Locus tag | PALA33_RS00890 | Protein ID | WP_003137009.1 |
| Coordinates | 191325..191552 (-) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PALA33_RS00860 (PALA33_00163) | 186298..187647 | + | 1350 | WP_003142411.1 | C4-dicarboxylate transporter DctA | - |
| PALA33_RS00865 (PALA33_00164) | 187696..188382 | + | 687 | WP_004351997.1 | FadR/GntR family transcriptional regulator | - |
| PALA33_RS00870 (PALA33_00165) | 188483..189217 | + | 735 | WP_003117208.1 | GntR family transcriptional regulator | - |
| PALA33_RS00875 (PALA33_00166) | 189397..189807 | + | 411 | WP_003101225.1 | aegerolysin family protein | - |
| PALA33_RS00880 (PALA33_00167) | 189839..190747 | - | 909 | WP_034068016.1 | LysR family transcriptional regulator | - |
| PALA33_RS00885 (PALA33_00168) | 191047..191328 | - | 282 | WP_009875660.1 | type II toxin-antitoxin system toxin ParE | Toxin |
| PALA33_RS00890 (PALA33_00169) | 191325..191552 | - | 228 | WP_003137009.1 | CopG family ribbon-helix-helix protein | Antitoxin |
| PALA33_RS00895 (PALA33_00170) | 191728..192348 | - | 621 | WP_023086863.1 | hypothetical protein | - |
| PALA33_RS00900 (PALA33_00171) | 192449..192949 | + | 501 | WP_003101228.1 | LEA type 2 family protein | - |
| PALA33_RS00905 (PALA33_00172) | 193022..193363 | + | 342 | WP_003101229.1 | zinc ribbon domain-containing protein YjdM | - |
| PALA33_RS00910 (PALA33_00173) | 193445..194872 | - | 1428 | WP_003083784.1 | GABA permease | - |
| PALA33_RS00915 (PALA33_00174) | 195041..196534 | - | 1494 | WP_003101230.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10461.25 Da Isoelectric Point: 10.4670
>T262186 WP_009875660.1 NZ_CP109845:c191328-191047 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLKRWPFSAPFRVKGKE
IQILRIDRVEITP
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLKRWPFSAPFRVKGKE
IQILRIDRVEITP
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7M2ZNP4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H2ZJU8 |