Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RHH(antitoxin)
Location 191047..191552 Replicon chromosome
Accession NZ_CP109845
Organism Pseudomonas aeruginosa strain PALA33

Toxin (Protein)


Gene name parE Uniprot ID A0A7M2ZNP4
Locus tag PALA33_RS00885 Protein ID WP_009875660.1
Coordinates 191047..191328 (-) Length 94 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID A0A0H2ZJU8
Locus tag PALA33_RS00890 Protein ID WP_003137009.1
Coordinates 191325..191552 (-) Length 76 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PALA33_RS00860 (PALA33_00163) 186298..187647 + 1350 WP_003142411.1 C4-dicarboxylate transporter DctA -
PALA33_RS00865 (PALA33_00164) 187696..188382 + 687 WP_004351997.1 FadR/GntR family transcriptional regulator -
PALA33_RS00870 (PALA33_00165) 188483..189217 + 735 WP_003117208.1 GntR family transcriptional regulator -
PALA33_RS00875 (PALA33_00166) 189397..189807 + 411 WP_003101225.1 aegerolysin family protein -
PALA33_RS00880 (PALA33_00167) 189839..190747 - 909 WP_034068016.1 LysR family transcriptional regulator -
PALA33_RS00885 (PALA33_00168) 191047..191328 - 282 WP_009875660.1 type II toxin-antitoxin system toxin ParE Toxin
PALA33_RS00890 (PALA33_00169) 191325..191552 - 228 WP_003137009.1 CopG family ribbon-helix-helix protein Antitoxin
PALA33_RS00895 (PALA33_00170) 191728..192348 - 621 WP_023086863.1 hypothetical protein -
PALA33_RS00900 (PALA33_00171) 192449..192949 + 501 WP_003101228.1 LEA type 2 family protein -
PALA33_RS00905 (PALA33_00172) 193022..193363 + 342 WP_003101229.1 zinc ribbon domain-containing protein YjdM -
PALA33_RS00910 (PALA33_00173) 193445..194872 - 1428 WP_003083784.1 GABA permease -
PALA33_RS00915 (PALA33_00174) 195041..196534 - 1494 WP_003101230.1 CoA-acylating methylmalonate-semialdehyde dehydrogenase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-87)

Antitoxin

Ribbon-helix-helix protein, CopG

(5-42)


Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 10461.25 Da        Isoelectric Point: 10.4670

>T262186 WP_009875660.1 NZ_CP109845:c191328-191047 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLKRWPFSAPFRVKGKE
IQILRIDRVEITP

Download         Length: 282 bp

Antitoxin


Download         Length: 76 a.a.        Molecular weight: 8526.56 Da        Isoelectric Point: 5.5740

>AT262186 WP_003137009.1 NZ_CP109845:c191552-191325 [Pseudomonas aeruginosa]
MSTVVSFRADDALVAALDELARATHRDRPYHLRQALAQYLERQQWQVAAIDEGLADANAGRLLEHAEIEKRWGLQ

Download         Length: 228 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7M2ZNP4

Antitoxin

Source ID Structure
AlphaFold DB A0A0H2ZJU8

References