Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-StbC
Location 1347959..1348629 Replicon chromosome
Accession NZ_CP109843
Organism Pseudomonas aeruginosa strain PALA29

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag PALA29_RS06430 Protein ID WP_023114647.1
Coordinates 1348210..1348629 (+) Length 140 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID -
Locus tag PALA29_RS06425 Protein ID WP_023114648.1
Coordinates 1347959..1348213 (+) Length 85 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PALA29_RS06405 (PALA29_01267) 1343500..1344492 - 993 WP_023114651.1 hypothetical protein -
PALA29_RS06410 (PALA29_01268) 1344586..1344810 + 225 WP_023114650.1 AlpA family phage regulatory protein -
PALA29_RS06415 (PALA29_01269) 1344813..1345706 + 894 WP_031637438.1 helicase RepA family protein -
PALA29_RS06420 1345687..1346664 + 978 WP_031637437.1 replication protein C, IncQ-type -
PALA29_RS06425 (PALA29_01270) 1347959..1348213 + 255 WP_023114648.1 Arc family DNA-binding protein Antitoxin
PALA29_RS06430 (PALA29_01271) 1348210..1348629 + 420 WP_023114647.1 type II toxin-antitoxin system VapC family toxin Toxin
PALA29_RS06435 (PALA29_01272) 1348785..1349555 + 771 WP_023114646.1 P-type conjugative transfer protein TrbJ -
PALA29_RS06440 (PALA29_01273) 1349569..1349727 + 159 WP_023114645.1 hypothetical protein -
PALA29_RS06445 (PALA29_01274) 1349729..1351201 + 1473 WP_023114644.1 P-type conjugative transfer protein TrbL -
PALA29_RS06450 (PALA29_01275) 1351270..1351512 + 243 WP_023114643.1 type I toxin-antitoxin system ptaRNA1 family toxin -
PALA29_RS06455 (PALA29_01276) 1351524..1351808 + 285 WP_023114642.1 hypothetical protein -
PALA29_RS06460 (PALA29_01277) 1351811..1352179 + 369 WP_023114641.1 conjugal transfer transcriptional regulator TraJ -
PALA29_RS06465 1352218..1352448 - 231 WP_229033214.1 hypothetical protein -
PALA29_RS06470 1352428..1352676 - 249 Protein_1281 XRE family transcriptional regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 1343500..1363111 19611


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(2-123)

Antitoxin

Arc-like DNA binding domain

(9-46)


Sequences

Toxin        


Download         Length: 140 a.a.        Molecular weight: 14925.16 Da        Isoelectric Point: 5.1890

>T262175 WP_023114647.1 NZ_CP109843:1348210-1348629 [Pseudomonas aeruginosa]
MIVLDTNVVSEAMKPEPNPAVRAWLNEQVVETLYLSSVTLAELLFGIGALPNGKRKKGLGEALDGLLELFGERVLMFDTE
AARHYAELAVKARTAGKGFPTPDGYIGAIAASKGFIVATRDTSPFEAAGLTVINPWNHQ

Download         Length: 420 bp

Antitoxin


Download         Length: 85 a.a.        Molecular weight: 9508.87 Da        Isoelectric Point: 6.4760

>AT262175 WP_023114648.1 NZ_CP109843:1347959-1348213 [Pseudomonas aeruginosa]
MAILTVRNVPDEVHRALRLRAAEHGRSTEAEVREILESAVKSEKRIRMGDALAELGRRVGLTNDDFAVLDQVRDKVPAEP
MRFE

Download         Length: 255 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References