Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
Location | 148138..148643 | Replicon | chromosome |
Accession | NZ_CP109843 | ||
Organism | Pseudomonas aeruginosa strain PALA29 |
Toxin (Protein)
Gene name | parE | Uniprot ID | - |
Locus tag | PALA29_RS00680 | Protein ID | WP_023114790.1 |
Coordinates | 148138..148419 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | A0A1C7BDS9 |
Locus tag | PALA29_RS00685 | Protein ID | WP_003083775.1 |
Coordinates | 148416..148643 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PALA29_RS00655 (PALA29_00123) | 143389..144738 | + | 1350 | WP_003119513.1 | C4-dicarboxylate transporter DctA | - |
PALA29_RS00660 (PALA29_00124) | 144787..145473 | + | 687 | WP_003083762.1 | FadR/GntR family transcriptional regulator | - |
PALA29_RS00665 (PALA29_00125) | 145574..146308 | + | 735 | WP_003117208.1 | GntR family transcriptional regulator | - |
PALA29_RS00670 (PALA29_00126) | 146488..146898 | + | 411 | WP_003101225.1 | aegerolysin family protein | - |
PALA29_RS00675 (PALA29_00127) | 146930..147838 | - | 909 | WP_003083769.1 | LysR family transcriptional regulator | - |
PALA29_RS00680 (PALA29_00128) | 148138..148419 | - | 282 | WP_023114790.1 | type II toxin-antitoxin system toxin ParE | Toxin |
PALA29_RS00685 (PALA29_00129) | 148416..148643 | - | 228 | WP_003083775.1 | CopG family ribbon-helix-helix protein | Antitoxin |
PALA29_RS00690 (PALA29_00130) | 148819..149439 | - | 621 | WP_003101226.1 | hypothetical protein | - |
PALA29_RS00695 (PALA29_00131) | 149540..150040 | + | 501 | WP_003101228.1 | LEA type 2 family protein | - |
PALA29_RS00700 (PALA29_00132) | 150113..150454 | + | 342 | WP_003101229.1 | zinc ribbon domain-containing protein YjdM | - |
PALA29_RS00705 (PALA29_00133) | 150536..151963 | - | 1428 | WP_003083784.1 | GABA permease | - |
PALA29_RS00710 (PALA29_00134) | 152132..153625 | - | 1494 | WP_016263977.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10464.21 Da Isoelectric Point: 10.0014
>T262174 WP_023114790.1 NZ_CP109843:c148419-148138 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDTIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDKVEITP
MSLKWTRKAAADLDTIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDKVEITP
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|