Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PRK09907-MazE
Location 23819..24426 Replicon plasmid pT17-1-4
Accession NZ_CP109842
Organism Enterococcus faecium strain T17-1

Toxin (Protein)


Gene name mazF Uniprot ID E3USU0
Locus tag OKL57_RS14265 Protein ID WP_002321032.1
Coordinates 24076..24426 (+) Length 117 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID A0A829F3C0
Locus tag OKL57_RS14260 Protein ID WP_002287514.1
Coordinates 23819..24082 (+) Length 88 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OKL57_RS14220 (OKL57_14215) 19418..19624 + 207 WP_002296239.1 hypothetical protein -
OKL57_RS14225 (OKL57_14220) 19624..19875 + 252 WP_002296238.1 hypothetical protein -
OKL57_RS14230 (OKL57_14225) 19890..20327 + 438 WP_002296237.1 hypothetical protein -
OKL57_RS14235 (OKL57_14230) 20320..21027 + 708 WP_127837488.1 hypothetical protein -
OKL57_RS14240 (OKL57_14235) 21192..21392 + 201 WP_002330566.1 hypothetical protein -
OKL57_RS14245 (OKL57_14240) 21408..21587 + 180 WP_002305761.1 hypothetical protein -
OKL57_RS14250 (OKL57_14245) 22013..22417 + 405 WP_002287522.1 IS200/IS605-like element ISEfa4 family transposase -
OKL57_RS14255 (OKL57_14250) 22434..23582 + 1149 WP_002287525.1 IS200/IS605 family element RNA-guided endonuclease TnpB -
OKL57_RS14260 (OKL57_14255) 23819..24082 + 264 WP_002287514.1 hypothetical protein Antitoxin
OKL57_RS14265 (OKL57_14260) 24076..24426 + 351 WP_002321032.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
OKL57_RS14270 (OKL57_14265) 24450..25064 - 615 WP_002318230.1 recombinase family protein -
OKL57_RS14275 (OKL57_14270) 25514..26839 + 1326 WP_123061350.1 Y-family DNA polymerase -
OKL57_RS14280 (OKL57_14275) 26832..27182 + 351 WP_002332658.1 hypothetical protein -
OKL57_RS14285 (OKL57_14280) 27398..27691 + 294 WP_002305210.1 hypothetical protein -
OKL57_RS14290 (OKL57_14285) 27917..28735 + 819 WP_002305212.1 ParA family protein -
OKL57_RS14295 (OKL57_14290) 28754..29161 + 408 WP_002305214.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..51108 51108


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(6-111)

Antitoxin

Antitoxin PemI-like

(4-87)


Sequences

Toxin        


Download         Length: 117 a.a.        Molecular weight: 13255.28 Da        Isoelectric Point: 8.0280

>T262173 WP_002321032.1 NZ_CP109842:24076-24426 [Enterococcus faecium]
MVRKPRQGDILLLNTAPRSGHEQTGKRPYIVLSHDIIADYSNVVTVAPISSTTRNYPLYVNINSEYEMKTTGKVLLDQLT
TIDYEARECIFLEKAHDSLVEELLMKVRTVFQKVSK

Download         Length: 351 bp

Antitoxin


Download         Length: 88 a.a.        Molecular weight: 10183.60 Da        Isoelectric Point: 4.6865

>AT262173 WP_002287514.1 NZ_CP109842:23819-24082 [Enterococcus faecium]
MEMLPIKKWGNSNGLRLPKYIMEYLGIHTEDKVKIIQEEVNGQKRLIIEAANIENELTIEQLFENYTDERNHVTIQNLGE
AVGNEKW

Download         Length: 264 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829F5H8

Antitoxin

Source ID Structure
AlphaFold DB A0A829F3C0

References