Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Xre-MNT/HTH_26(antitoxin) |
Location | 75264..76372 | Replicon | plasmid pT17-1-1 |
Accession | NZ_CP109841 | ||
Organism | Enterococcus faecium strain T17-1 |
Toxin (Protein)
Gene name | MNTss | Uniprot ID | R3JIN1 |
Locus tag | OKL57_RS13565 | Protein ID | WP_000233000.1 |
Coordinates | 75264..76133 (-) | Length | 290 a.a. |
Antitoxin (Protein)
Gene name | Xress | Uniprot ID | - |
Locus tag | OKL57_RS13570 | Protein ID | WP_000205227.1 |
Coordinates | 76148..76372 (-) | Length | 75 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OKL57_RS13535 (OKL57_13530) | 70426..71106 | + | 681 | WP_001015311.1 | IS6-like element IS1216 family transposase | - |
OKL57_RS13540 (OKL57_13535) | 71334..71906 | - | 573 | WP_202074493.1 | HTH domain-containing protein | - |
OKL57_RS13545 (OKL57_13540) | 72182..72976 | - | 795 | WP_001096887.1 | aminoglycoside O-phosphotransferase APH(3')-IIIa | - |
OKL57_RS13550 (OKL57_13545) | 73069..73611 | - | 543 | WP_000627290.1 | streptothricin N-acetyltransferase Sat4 | - |
OKL57_RS13555 (OKL57_13550) | 73608..74516 | - | 909 | WP_001255866.1 | aminoglycoside nucleotidyltransferase ANT(6)-Ia | - |
OKL57_RS13560 (OKL57_13555) | 74549..75283 | - | 735 | WP_000662263.1 | class I SAM-dependent methyltransferase | - |
OKL57_RS13565 (OKL57_13560) | 75264..76133 | - | 870 | WP_000233000.1 | nucleotidyltransferase domain-containing protein | Toxin |
OKL57_RS13570 (OKL57_13565) | 76148..76372 | - | 225 | WP_000205227.1 | helix-turn-helix transcriptional regulator | Antitoxin |
OKL57_RS13575 (OKL57_13570) | 76515..76744 | - | 230 | Protein_90 | hypothetical protein | - |
OKL57_RS13580 (OKL57_13575) | 76810..78092 | + | 1283 | Protein_91 | ISL3 family transposase | - |
OKL57_RS13585 (OKL57_13580) | 78401..79204 | - | 804 | WP_002294514.1 | lincosamide nucleotidyltransferase Lnu(B) | - |
OKL57_RS13590 (OKL57_13585) | 79258..80742 | - | 1485 | WP_002294513.1 | ABC-F type ribosomal protection protein Lsa(E) | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 290 a.a. Molecular weight: 32926.57 Da Isoelectric Point: 4.8781
>T262172 WP_000233000.1 NZ_CP109841:c76133-75264 [Enterococcus faecium]
MVGNVIQIVTEKLSSLPFIEGIVLGGSRARGTHTENSDIDIGIYYNSDSFDLTAINQIATELDDKNRNNLVVPPGAWGDW
INGGGWLFINGYHVDLILRDIKRVEQIIKDTEQGIVTANYQTGHPHGYISAMYRGELAISKILYAKNESLCELKKQAEIY
PTALKKSLMNFFIFEAEFSLMFVKANAGVEDKYYIAGHVFRIISCLNQVLFACNNAYCINEKKAIKLLETFEYKPEKYAE
RVNHIFEVLGLSLFECYDMTEKLYKEVNEIVSEINNFLNEESSDERKQI
MVGNVIQIVTEKLSSLPFIEGIVLGGSRARGTHTENSDIDIGIYYNSDSFDLTAINQIATELDDKNRNNLVVPPGAWGDW
INGGGWLFINGYHVDLILRDIKRVEQIIKDTEQGIVTANYQTGHPHGYISAMYRGELAISKILYAKNESLCELKKQAEIY
PTALKKSLMNFFIFEAEFSLMFVKANAGVEDKYYIAGHVFRIISCLNQVLFACNNAYCINEKKAIKLLETFEYKPEKYAE
RVNHIFEVLGLSLFECYDMTEKLYKEVNEIVSEINNFLNEESSDERKQI
Download Length: 870 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|