Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | omega-epsilon-zeta/zeta-epsilon |
| Location | 8255..9392 | Replicon | plasmid pT17-1-optrA-57k |
| Accession | NZ_CP109840 | ||
| Organism | Enterococcus faecium strain T17-1 | ||
Toxin (Protein)
| Gene name | zeta | Uniprot ID | Q54944 |
| Locus tag | OKL57_RS12835 | Protein ID | WP_001284311.1 |
| Coordinates | 8255..9118 (-) | Length | 288 a.a. |
Antitoxin (Protein)
| Gene name | epsilon | Uniprot ID | R2XCR7 |
| Locus tag | OKL57_RS12840 | Protein ID | WP_000301765.1 |
| Coordinates | 9120..9392 (-) | Length | 91 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OKL57_RS12800 (OKL57_12795) | 4482..4625 | - | 144 | WP_002360221.1 | hypothetical protein | - |
| OKL57_RS12805 (OKL57_12800) | 5073..5207 | + | 135 | Protein_4 | DNA repair protein RadC | - |
| OKL57_RS12810 (OKL57_12805) | 5430..5813 | + | 384 | Protein_5 | N-6 DNA methylase | - |
| OKL57_RS12815 (OKL57_12810) | 5869..6549 | - | 681 | WP_001015311.1 | IS6-like element IS1216 family transposase | - |
| OKL57_RS12820 (OKL57_12815) | 6603..6725 | - | 123 | WP_159111623.1 | DpnD/PcfM family protein | - |
| OKL57_RS12825 (OKL57_12820) | 6760..7257 | - | 498 | WP_010713926.1 | molecular chaperone DnaJ | - |
| OKL57_RS12830 (OKL57_12825) | 7791..8108 | - | 318 | WP_002300567.1 | hypothetical protein | - |
| OKL57_RS12835 (OKL57_12830) | 8255..9118 | - | 864 | WP_001284311.1 | zeta toxin family protein | Toxin |
| OKL57_RS12840 (OKL57_12835) | 9120..9392 | - | 273 | WP_000301765.1 | antitoxin | Antitoxin |
| OKL57_RS12845 (OKL57_12840) | 9409..9624 | - | 216 | WP_001835296.1 | peptide-binding protein | - |
| OKL57_RS12850 (OKL57_12845) | 9758..10018 | - | 261 | Protein_13 | topoisomerase DNA-binding C4 zinc finger domain-containing protein | - |
| OKL57_RS12855 (OKL57_12850) | 10188..10931 | - | 744 | Protein_14 | 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B) | - |
| OKL57_RS12860 (OKL57_12855) | 11050..11133 | - | 84 | WP_001865637.1 | 23S rRNA methyltransferase attenuation leader peptide | - |
| OKL57_RS12865 (OKL57_12860) | 11182..11421 | - | 240 | WP_000635249.1 | peptide-binding protein | - |
| OKL57_RS12870 (OKL57_12865) | 11555..13699 | - | 2145 | WP_264460529.1 | type IA DNA topoisomerase | - |
| OKL57_RS12875 (OKL57_12870) | 13699..14316 | - | 618 | WP_001062589.1 | recombinase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | optrA / fexA / erm(B) / erm(A) | - | 1..57547 | 57547 | |
| - | inside | IS/Tn | optrA / fexA / erm(B) | - | 518..10925 | 10407 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 288 a.a. Molecular weight: 32404.02 Da Isoelectric Point: 6.9964
>T262171 WP_001284311.1 NZ_CP109840:c9118-8255 [Enterococcus faecium]
MANIVNFTDKQFENRLNDNLEELIQGKKAVESPTAFLLGGQPGSGKTSLRSAIFEETQGNVIVIDNDTFKQQHPNFDELV
KLYEKDVVKHVTPYSNRMTEAIISRLSDQGYNLVIEGTGRTTDVPIQTATMLQAKGYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLEKELNRKVSGKEIQ
PTLERIEQKMVLNKHQETPEFKAIQQKLESLQPPTPPIPKTPKLPGI
MANIVNFTDKQFENRLNDNLEELIQGKKAVESPTAFLLGGQPGSGKTSLRSAIFEETQGNVIVIDNDTFKQQHPNFDELV
KLYEKDVVKHVTPYSNRMTEAIISRLSDQGYNLVIEGTGRTTDVPIQTATMLQAKGYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLEKELNRKVSGKEIQ
PTLERIEQKMVLNKHQETPEFKAIQQKLESLQPPTPPIPKTPKLPGI
Download Length: 864 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 1GVN | |
| PDB | 3Q8X |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 3Q8X | |
| PDB | 1GVN | |
| AlphaFold DB | A0A829F0A3 |