Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
Location | 495006..495577 | Replicon | chromosome |
Accession | NZ_CP109839 | ||
Organism | Enterococcus faecium strain T17-1 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | OKL57_RS02685 | Protein ID | WP_142652303.1 |
Coordinates | 495236..495577 (+) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | A0A828ZZN9 |
Locus tag | OKL57_RS02680 | Protein ID | WP_002323011.1 |
Coordinates | 495006..495236 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OKL57_RS02655 (OKL57_02655) | 490487..491815 | + | 1329 | WP_002327434.1 | FAD-containing oxidoreductase | - |
OKL57_RS02660 (OKL57_02660) | 491837..492463 | + | 627 | WP_002286816.1 | cysteine hydrolase | - |
OKL57_RS02665 (OKL57_02665) | 492646..493227 | + | 582 | WP_002327433.1 | TetR/AcrR family transcriptional regulator | - |
OKL57_RS02670 (OKL57_02670) | 493592..494167 | + | 576 | WP_002352505.1 | SOS response-associated peptidase family protein | - |
OKL57_RS02675 (OKL57_02675) | 494372..494710 | - | 339 | WP_002306002.1 | hypothetical protein | - |
OKL57_RS02680 (OKL57_02680) | 495006..495236 | + | 231 | WP_002323011.1 | hypothetical protein | Antitoxin |
OKL57_RS02685 (OKL57_02685) | 495236..495577 | + | 342 | WP_142652303.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
OKL57_RS02690 (OKL57_02690) | 496427..496612 | + | 186 | WP_002304207.1 | hypothetical protein | - |
OKL57_RS02695 (OKL57_02695) | 496882..498044 | + | 1163 | WP_086956687.1 | IS3 family transposase | - |
OKL57_RS02700 (OKL57_02700) | 498166..498408 | + | 243 | Protein_476 | LPXTG cell wall anchor domain-containing protein | - |
OKL57_RS02705 (OKL57_02705) | 498482..499378 | + | 897 | WP_002352497.1 | class C sortase | - |
OKL57_RS02710 (OKL57_02710) | 499559..500233 | + | 675 | WP_002291233.1 | response regulator transcription factor | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13316.70 Da Isoelectric Point: 9.9044
>T262170 WP_142652303.1 NZ_CP109839:495236-495577 [Enterococcus faecium]
VSEERIYIPKKGDIVWIDFEPSVGKEIQKRRPGLVVSRYEFNRKTMFSVICPITSTIKNLPTRYSLPEELDIKGQVIITQ
LKSLDFKERKLKKIENLPLQDMAKIDQIIQYMF
VSEERIYIPKKGDIVWIDFEPSVGKEIQKRRPGLVVSRYEFNRKTMFSVICPITSTIKNLPTRYSLPEELDIKGQVIITQ
LKSLDFKERKLKKIENLPLQDMAKIDQIIQYMF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|