Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 2888701..2889352 Replicon chromosome
Accession NZ_CP109836
Organism Acinetobacter baumannii strain Z198

Toxin (Protein)


Gene name hicA Uniprot ID S3TWT7
Locus tag OHJ24_RS14160 Protein ID WP_000838146.1
Coordinates 2889170..2889352 (-) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID A0A0J1AAF8
Locus tag OHJ24_RS14155 Protein ID WP_000966689.1
Coordinates 2888701..2889105 (-) Length 135 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OHJ24_RS14145 (OHJ24_14155) 2884022..2887990 - 3969 WP_000191303.1 tape measure protein -
OHJ24_RS14150 (OHJ24_14160) 2888087..2888605 - 519 WP_053530939.1 DUF4468 domain-containing protein -
OHJ24_RS14155 (OHJ24_14165) 2888701..2889105 - 405 WP_000966689.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
OHJ24_RS14160 (OHJ24_14170) 2889170..2889352 - 183 WP_000838146.1 type II toxin-antitoxin system HicA family toxin Toxin
OHJ24_RS14165 (OHJ24_14175) 2889684..2890217 - 534 WP_001185622.1 hypothetical protein -
OHJ24_RS14170 (OHJ24_14180) 2890262..2891191 - 930 WP_000094300.1 phage tail tube protein -
OHJ24_RS14175 (OHJ24_14185) 2891299..2891511 - 213 WP_000121166.1 hypothetical protein -
OHJ24_RS14180 (OHJ24_14190) 2891513..2891911 - 399 WP_001132270.1 hypothetical protein -
OHJ24_RS14185 (OHJ24_14195) 2891913..2892281 - 369 WP_000539752.1 hypothetical protein -
OHJ24_RS14190 (OHJ24_14200) 2892253..2892657 - 405 WP_000248324.1 hypothetical protein -
OHJ24_RS14195 (OHJ24_14205) 2892666..2893034 - 369 WP_000524231.1 hypothetical protein -
OHJ24_RS14200 (OHJ24_14210) 2893036..2893425 - 390 WP_000008492.1 hypothetical protein -
OHJ24_RS14205 (OHJ24_14215) 2893430..2894095 - 666 WP_000767881.1 Ish1 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 2865354..2917864 52510


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(5-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(3-126)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6695.84 Da        Isoelectric Point: 10.5523

>T262166 WP_000838146.1 NZ_CP109836:c2889352-2889170 [Acinetobacter baumannii]
VKSLDLIKMIEADGWYEVRVSGSHHHFKHPTKKGLVTIPHPKKDLPNGTVKSILKQAGLN

Download         Length: 183 bp

Antitoxin


Download         Length: 135 a.a.        Molecular weight: 14769.78 Da        Isoelectric Point: 4.5000

>AT262166 WP_000966689.1 NZ_CP109836:c2889105-2888701 [Acinetobacter baumannii]
MLYPIAIERGTDTEAFGVSVPDIPGCFSAGDTLYEAIENVKEAISGHLEILAEDGEEIPLASDVSKFIDQEDYRGMIWAV
TEVDVSRYLGKPEKINVTLPSRLIRKIDDNVGKDKRFKTRSAFLAAGAEKLLHA

Download         Length: 405 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S3TWT7

Antitoxin

Source ID Structure
AlphaFold DB A0A0J1AAF8

References