Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 5446280..5446920 | Replicon | chromosome |
| Accession | NZ_CP109835 | ||
| Organism | Pseudomonas aeruginosa strain PALA26 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | PALA26_RS25455 | Protein ID | WP_003134109.1 |
| Coordinates | 5446280..5446690 (-) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | PALA26_RS25460 | Protein ID | WP_031634724.1 |
| Coordinates | 5446690..5446920 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PALA26_RS25415 | 5441806..5442603 | + | 798 | WP_235597565.1 | hypothetical protein | - |
| PALA26_RS25420 (PALA26_05029) | 5442760..5443488 | + | 729 | WP_004352842.1 | TIGR03761 family integrating conjugative element protein | - |
| PALA26_RS25425 (PALA26_05030) | 5443494..5444042 | + | 549 | WP_004352841.1 | DUF3158 family protein | - |
| PALA26_RS25430 (PALA26_05031) | 5444089..5444928 | + | 840 | WP_003105750.1 | Rha family transcriptional regulator | - |
| PALA26_RS25435 (PALA26_05032) | 5444958..5445446 | + | 489 | WP_004352840.1 | single-stranded DNA-binding protein | - |
| PALA26_RS25440 | 5445602..5445769 | + | 168 | WP_128729268.1 | CrpP family ICE-associated protein | - |
| PALA26_RS25445 (PALA26_05033) | 5445835..5446053 | - | 219 | WP_023083218.1 | hypothetical protein | - |
| PALA26_RS25450 (PALA26_05034) | 5446067..5446264 | - | 198 | WP_023083219.1 | hypothetical protein | - |
| PALA26_RS25455 (PALA26_05035) | 5446280..5446690 | - | 411 | WP_003134109.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
| PALA26_RS25460 | 5446690..5446920 | - | 231 | WP_031634724.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| PALA26_RS25465 (PALA26_05036) | 5447176..5449095 | + | 1920 | WP_004352838.1 | type I DNA topoisomerase | - |
| PALA26_RS25470 | 5449403..5449612 | + | 210 | WP_003105733.1 | cold-shock protein | - |
| PALA26_RS25475 (PALA26_05037) | 5449833..5451722 | + | 1890 | WP_003105732.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 5427923..5516766 | 88843 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 15452.78 Da Isoelectric Point: 7.3233
>T262164 WP_003134109.1 NZ_CP109835:c5446690-5446280 [Pseudomonas aeruginosa]
MLKFMLDTNICIFTIKNRPQEVREAFLRHHDQMCISTVTLMELIYGAEKSSNPSRNLADVEGFAARLEVLKYDQEAAAHT
GQLRAELARLGKQIGPYDQMIAGHARSQGLIVVTNNRREFDRVPGLRVEDWVTPIV
MLKFMLDTNICIFTIKNRPQEVREAFLRHHDQMCISTVTLMELIYGAEKSSNPSRNLADVEGFAARLEVLKYDQEAAAHT
GQLRAELARLGKQIGPYDQMIAGHARSQGLIVVTNNRREFDRVPGLRVEDWVTPIV
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|