Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VagC
Location 5446280..5446920 Replicon chromosome
Accession NZ_CP109835
Organism Pseudomonas aeruginosa strain PALA26

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag PALA26_RS25455 Protein ID WP_003134109.1
Coordinates 5446280..5446690 (-) Length 137 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID -
Locus tag PALA26_RS25460 Protein ID WP_031634724.1
Coordinates 5446690..5446920 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PALA26_RS25415 5441806..5442603 + 798 WP_235597565.1 hypothetical protein -
PALA26_RS25420 (PALA26_05029) 5442760..5443488 + 729 WP_004352842.1 TIGR03761 family integrating conjugative element protein -
PALA26_RS25425 (PALA26_05030) 5443494..5444042 + 549 WP_004352841.1 DUF3158 family protein -
PALA26_RS25430 (PALA26_05031) 5444089..5444928 + 840 WP_003105750.1 Rha family transcriptional regulator -
PALA26_RS25435 (PALA26_05032) 5444958..5445446 + 489 WP_004352840.1 single-stranded DNA-binding protein -
PALA26_RS25440 5445602..5445769 + 168 WP_128729268.1 CrpP family ICE-associated protein -
PALA26_RS25445 (PALA26_05033) 5445835..5446053 - 219 WP_023083218.1 hypothetical protein -
PALA26_RS25450 (PALA26_05034) 5446067..5446264 - 198 WP_023083219.1 hypothetical protein -
PALA26_RS25455 (PALA26_05035) 5446280..5446690 - 411 WP_003134109.1 tRNA(fMet)-specific endonuclease VapC Toxin
PALA26_RS25460 5446690..5446920 - 231 WP_031634724.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
PALA26_RS25465 (PALA26_05036) 5447176..5449095 + 1920 WP_004352838.1 type I DNA topoisomerase -
PALA26_RS25470 5449403..5449612 + 210 WP_003105733.1 cold-shock protein -
PALA26_RS25475 (PALA26_05037) 5449833..5451722 + 1890 WP_003105732.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 5427923..5516766 88843


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-124)

Antitoxin

SpoVT-AbrB domain

(7-33)


Sequences

Toxin        


Download         Length: 137 a.a.        Molecular weight: 15452.78 Da        Isoelectric Point: 7.3233

>T262164 WP_003134109.1 NZ_CP109835:c5446690-5446280 [Pseudomonas aeruginosa]
MLKFMLDTNICIFTIKNRPQEVREAFLRHHDQMCISTVTLMELIYGAEKSSNPSRNLADVEGFAARLEVLKYDQEAAAHT
GQLRAELARLGKQIGPYDQMIAGHARSQGLIVVTNNRREFDRVPGLRVEDWVTPIV

Download         Length: 411 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8420.29 Da        Isoelectric Point: 4.2821

>AT262164 WP_031634724.1 NZ_CP109835:c5446920-5446690 [Pseudomonas aeruginosa]
VEQGSVFQSNRSQAVRLPKAVALPDDVKRVDVVAVGRARIITPAGESWDSWFDGEGVTADFMAEREQPADQERETF

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References