Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
Location | 143191..143696 | Replicon | chromosome |
Accession | NZ_CP109833 | ||
Organism | Pseudomonas aeruginosa strain PALA23 |
Toxin (Protein)
Gene name | parE | Uniprot ID | V6A7K8 |
Locus tag | PALA23_RS00665 | Protein ID | WP_003083773.1 |
Coordinates | 143191..143472 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | A0A1C7BDS9 |
Locus tag | PALA23_RS00670 | Protein ID | WP_003083775.1 |
Coordinates | 143469..143696 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PALA23_RS00640 (PALA23_00124) | 138442..139791 | + | 1350 | WP_003142411.1 | C4-dicarboxylate transporter DctA | - |
PALA23_RS00645 (PALA23_00125) | 139840..140526 | + | 687 | WP_003083762.1 | FadR/GntR family transcriptional regulator | - |
PALA23_RS00650 (PALA23_00126) | 140627..141361 | + | 735 | WP_043089546.1 | GntR family transcriptional regulator | - |
PALA23_RS00655 (PALA23_00127) | 141541..141951 | + | 411 | WP_003101225.1 | aegerolysin family protein | - |
PALA23_RS00660 (PALA23_00128) | 141983..142891 | - | 909 | WP_003083769.1 | LysR family transcriptional regulator | - |
PALA23_RS00665 (PALA23_00129) | 143191..143472 | - | 282 | WP_003083773.1 | type II toxin-antitoxin system toxin ParE | Toxin |
PALA23_RS00670 (PALA23_00130) | 143469..143696 | - | 228 | WP_003083775.1 | CopG family ribbon-helix-helix protein | Antitoxin |
PALA23_RS00675 (PALA23_00131) | 143872..144492 | - | 621 | WP_003101226.1 | hypothetical protein | - |
PALA23_RS00680 (PALA23_00132) | 144593..145093 | + | 501 | WP_003101228.1 | LEA type 2 family protein | - |
PALA23_RS00685 (PALA23_00133) | 145166..145507 | + | 342 | WP_003101229.1 | zinc ribbon domain-containing protein YjdM | - |
PALA23_RS00690 (PALA23_00134) | 145589..147016 | - | 1428 | WP_003083784.1 | GABA permease | - |
PALA23_RS00695 (PALA23_00135) | 147185..148678 | - | 1494 | WP_016263977.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10462.19 Da Isoelectric Point: 10.0435
>T262149 WP_003083773.1 NZ_CP109833:c143472-143191 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|