Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 4305468..4306137 | Replicon | chromosome |
| Accession | NZ_CP109824 | ||
| Organism | Serratia marcescens strain SMBC31 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | - |
| Locus tag | OHY99_RS20875 | Protein ID | WP_025304123.1 |
| Coordinates | 4305468..4305890 (-) | Length | 141 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | A0A8G2G4M4 |
| Locus tag | OHY99_RS20880 | Protein ID | WP_004931679.1 |
| Coordinates | 4305871..4306137 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OHY99_RS20855 (OHY99_20860) | 4301357..4301875 | + | 519 | WP_025304119.1 | flavodoxin FldB | - |
| OHY99_RS20860 (OHY99_20865) | 4301913..4303277 | - | 1365 | WP_197837477.1 | cell envelope integrity protein CreD | - |
| OHY99_RS20865 (OHY99_20870) | 4303358..4304776 | - | 1419 | WP_169540605.1 | two-component system sensor histidine kinase CreC | - |
| OHY99_RS20870 (OHY99_20875) | 4304773..4305468 | - | 696 | WP_025304122.1 | two-component system response regulator CreB | - |
| OHY99_RS20875 (OHY99_20880) | 4305468..4305890 | - | 423 | WP_025304123.1 | protein YgfX | Toxin |
| OHY99_RS20880 (OHY99_20885) | 4305871..4306137 | - | 267 | WP_004931679.1 | FAD assembly factor SdhE | Antitoxin |
| OHY99_RS20885 (OHY99_20890) | 4306458..4307450 | + | 993 | WP_025304124.1 | tRNA-modifying protein YgfZ | - |
| OHY99_RS20890 (OHY99_20895) | 4307489..4307986 | - | 498 | WP_025304125.1 | DUF2165 domain-containing protein | - |
| OHY99_RS20895 (OHY99_20900) | 4308137..4308811 | - | 675 | WP_033639467.1 | hemolysin III family protein | - |
| OHY99_RS20900 (OHY99_20905) | 4308995..4309603 | + | 609 | WP_025304127.1 | HD domain-containing protein | - |
| OHY99_RS20905 (OHY99_20910) | 4309643..4310569 | - | 927 | WP_025304128.1 | ribokinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 141 a.a. Molecular weight: 16525.62 Da Isoelectric Point: 10.8432
>T262142 WP_025304123.1 NZ_CP109824:c4305890-4305468 [Serratia marcescens]
VAQWRCDIRISWRTQLFSLLTHGVLILLILISPWPEGYGPLWLVLLTLVVFQCIRSQKRIAAVQGELRLLADRRFSWHGR
EWRLAKKPWMPGYGLLLTLQPMEGKKRRRLWLASDCMSKEEWRHLRQLLLYPPAGNGEEP
VAQWRCDIRISWRTQLFSLLTHGVLILLILISPWPEGYGPLWLVLLTLVVFQCIRSQKRIAAVQGELRLLADRRFSWHGR
EWRLAKKPWMPGYGLLLTLQPMEGKKRRRLWLASDCMSKEEWRHLRQLLLYPPAGNGEEP
Download Length: 423 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|