Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 3900362..3901018 | Replicon | chromosome |
Accession | NZ_CP109824 | ||
Organism | Serratia marcescens strain SMBC31 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | OHY99_RS18865 | Protein ID | WP_264383682.1 |
Coordinates | 3900362..3900751 (-) | Length | 130 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | OHY99_RS18870 | Protein ID | WP_262237513.1 |
Coordinates | 3900755..3901018 (-) | Length | 88 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OHY99_RS18850 (OHY99_18855) | 3896829..3898259 | + | 1431 | WP_049204855.1 | MFS transporter | - |
OHY99_RS18855 (OHY99_18860) | 3898256..3899638 | + | 1383 | WP_049204856.1 | two-component system sensor histidine kinase BaeS | - |
OHY99_RS18860 (OHY99_18865) | 3899638..3900354 | + | 717 | WP_004941568.1 | two-component system response regulator BaeR | - |
OHY99_RS18865 (OHY99_18870) | 3900362..3900751 | - | 390 | WP_264383682.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
OHY99_RS18870 (OHY99_18875) | 3900755..3901018 | - | 264 | WP_262237513.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
OHY99_RS18875 (OHY99_18880) | 3901356..3901694 | + | 339 | WP_016926703.1 | YegP family protein | - |
OHY99_RS18880 (OHY99_18885) | 3901873..3903225 | + | 1353 | WP_025303865.1 | tRNA 5-hydroxyuridine modification protein YegQ | - |
OHY99_RS18885 (OHY99_18890) | 3903442..3903663 | - | 222 | WP_141998673.1 | hypothetical protein | - |
OHY99_RS18890 (OHY99_18895) | 3903693..3904598 | + | 906 | WP_043137977.1 | lipid kinase YegS | - |
OHY99_RS18895 (OHY99_18900) | 3904767..3905981 | + | 1215 | WP_025303867.1 | D-galactonate dehydratase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 14393.75 Da Isoelectric Point: 9.5570
>T262139 WP_264383682.1 NZ_CP109824:c3900751-3900362 [Serratia marcescens]
MYMFDTNTVSHLFRQHPQVLNVMQKLPPSAVCISSVTEAELLYGVAKRRNKALQSMVEAFLAAVTVYAWDREAARCYGEM
RANMVRKGKIMGAMDQLIAAHAQSRGATLVTNDRAFAMVPGLAVEDWTR
MYMFDTNTVSHLFRQHPQVLNVMQKLPPSAVCISSVTEAELLYGVAKRRNKALQSMVEAFLAAVTVYAWDREAARCYGEM
RANMVRKGKIMGAMDQLIAAHAQSRGATLVTNDRAFAMVPGLAVEDWTR
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|