Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 1573291..1573838 | Replicon | chromosome |
Accession | NZ_CP109824 | ||
Organism | Serratia marcescens strain SMBC31 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | - |
Locus tag | OHY99_RS07775 | Protein ID | WP_049208872.1 |
Coordinates | 1573530..1573838 (+) | Length | 103 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | - |
Locus tag | OHY99_RS07770 | Protein ID | WP_025302143.1 |
Coordinates | 1573291..1573527 (+) | Length | 79 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OHY99_RS07755 (OHY99_07755) | 1569777..1571312 | + | 1536 | WP_089180702.1 | glutathione ABC transporter substrate-binding protein GsiB | - |
OHY99_RS07760 (OHY99_07760) | 1571365..1572285 | + | 921 | WP_025302141.1 | glutathione ABC transporter permease GsiC | - |
OHY99_RS07765 (OHY99_07765) | 1572295..1573203 | + | 909 | WP_169540348.1 | glutathione ABC transporter permease GsiD | - |
OHY99_RS07770 (OHY99_07770) | 1573291..1573527 | + | 237 | WP_025302143.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
OHY99_RS07775 (OHY99_07775) | 1573530..1573838 | + | 309 | WP_049208872.1 | CcdB family protein | Toxin |
OHY99_RS07780 (OHY99_07780) | 1573878..1574720 | - | 843 | WP_015377214.1 | S-formylglutathione hydrolase | - |
OHY99_RS07785 (OHY99_07785) | 1574735..1575859 | - | 1125 | WP_043142415.1 | S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase | - |
OHY99_RS07790 (OHY99_07790) | 1575890..1576810 | - | 921 | WP_043142419.1 | LysR family transcriptional regulator | - |
OHY99_RS07795 (OHY99_07795) | 1576916..1578073 | + | 1158 | WP_043142422.1 | YbfB/YjiJ family MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | galU / wza / galE / gnd / manB | 1426204..1726001 | 299797 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11518.35 Da Isoelectric Point: 5.0196
>T262133 WP_049208872.1 NZ_CP109824:1573530-1573838 [Serratia marcescens]
MQFTVYDNTYPASAYPYLLDVQSDLIDVLSTRLMIPLYALDNVRVKISARLCPEIEVNGEKFLVMTHEMAAIRISQIGKA
VGNVNEHRNQIKAAIDFLIDGF
MQFTVYDNTYPASAYPYLLDVQSDLIDVLSTRLMIPLYALDNVRVKISARLCPEIEVNGEKFLVMTHEMAAIRISQIGKA
VGNVNEHRNQIKAAIDFLIDGF
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|