Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/ParE-YefM
Location 1445514..1446081 Replicon chromosome
Accession NZ_CP109824
Organism Serratia marcescens strain SMBC31

Toxin (Protein)


Gene name parE Uniprot ID -
Locus tag OHY99_RS07085 Protein ID WP_028127915.1
Coordinates 1445514..1445819 (-) Length 102 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID A0A8B4G8D1
Locus tag OHY99_RS07090 Protein ID WP_016928576.1
Coordinates 1445821..1446081 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OHY99_RS07050 (OHY99_07050) 1441163..1442239 + 1077 WP_025302022.1 urea ABC transporter permease subunit UrtC -
OHY99_RS07055 (OHY99_07055) 1442236..1443042 + 807 WP_015377102.1 urea ABC transporter ATP-binding protein UrtD -
OHY99_RS07060 (OHY99_07060) 1443055..1443753 + 699 WP_046686646.1 urea ABC transporter ATP-binding subunit UrtE -
OHY99_RS07065 (OHY99_07065) 1443761..1444060 - 300 WP_049295232.1 type II toxin-antitoxin system RelE/ParE family toxin -
OHY99_RS07070 (OHY99_07070) 1444045..1444308 - 264 WP_043136944.1 type II toxin-antitoxin system ParD family antitoxin -
OHY99_RS07075 (OHY99_07075) 1444443..1444955 + 513 WP_004939438.1 DUF2165 family protein -
OHY99_RS07080 (OHY99_07080) 1444977..1445489 - 513 WP_049208922.1 GNAT family N-acetyltransferase -
OHY99_RS07085 (OHY99_07085) 1445514..1445819 - 306 WP_028127915.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
OHY99_RS07090 (OHY99_07090) 1445821..1446081 - 261 WP_016928576.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
OHY99_RS07095 (OHY99_07095) 1446150..1447385 - 1236 WP_142590643.1 FAD-dependent oxidoreductase -
OHY99_RS07100 (OHY99_07100) 1447462..1447800 - 339 WP_237651447.1 DUF4865 family protein -
OHY99_RS07105 (OHY99_07105) 1448058..1448456 + 399 WP_049203899.1 hypothetical protein -
OHY99_RS07110 (OHY99_07110) 1448502..1448789 - 288 WP_072269807.1 colicin Z C-terminal domain-related protein -
OHY99_RS07115 (OHY99_07115) 1448805..1449011 - 207 WP_072269808.1 hypothetical protein -
OHY99_RS07120 (OHY99_07120) 1449410..1449559 - 150 Protein_1363 DUF4865 family protein -
OHY99_RS07125 (OHY99_07125) 1449665..1450534 + 870 WP_025302028.1 LysR substrate-binding domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - galU / wza / galE / gnd / manB 1426204..1726001 299797


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-92)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(3-65)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11954.71 Da        Isoelectric Point: 9.5902

>T262132 WP_028127915.1 NZ_CP109824:c1445819-1445514 [Serratia marcescens]
MPAFRLTPQAQQDLLAIRHFTIEHWGQAQSRRYLEQLREVMHHLADMPEAGKAHFHDLGEEIRSFPYASHRIYYRNRPAG
ITVLAILHQAMVPHRHLEQRL

Download         Length: 306 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9442.59 Da        Isoelectric Point: 4.1964

>AT262132 WP_016928576.1 NZ_CP109824:c1446081-1445821 [Serratia marcescens]
MYALTANEAKTQFGDLLLKAQREPVQINRNGKPVAVVMSVEDYQALEDLKLSALQQKIAQATAEEDAGKAVDGDAFFNRL
LTDETD

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A8B4G8D1

References