Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 1057169..1057791 Replicon chromosome
Accession NZ_CP109824
Organism Serratia marcescens strain SMBC31

Toxin (Protein)


Gene name Hha Uniprot ID A0A8B4G7F9
Locus tag OHY99_RS04970 Protein ID WP_004940313.1
Coordinates 1057169..1057372 (-) Length 68 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID A0A2X2G5J9
Locus tag OHY99_RS04975 Protein ID WP_004940312.1
Coordinates 1057423..1057791 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OHY99_RS04940 (OHY99_04940) 1052868..1053206 + 339 WP_004940327.1 P-II family nitrogen regulator -
OHY99_RS04945 (OHY99_04945) 1053243..1054529 + 1287 WP_049295142.1 ammonium transporter AmtB -
OHY99_RS04950 (OHY99_04950) 1054620..1055483 - 864 WP_016928847.1 acyl-CoA thioesterase II -
OHY99_RS04955 (OHY99_04955) 1055715..1056206 + 492 WP_025301777.1 YbaY family lipoprotein -
OHY99_RS04960 (OHY99_04960) 1056271..1056585 - 315 WP_025301778.1 MGMT family protein -
OHY99_RS04970 (OHY99_04970) 1057169..1057372 - 204 WP_004940313.1 HHA domain-containing protein Toxin
OHY99_RS04975 (OHY99_04975) 1057423..1057791 - 369 WP_004940312.1 Hha toxicity modulator TomB Antitoxin
OHY99_RS04980 (OHY99_04980) 1057950..1058303 - 354 WP_025301779.1 hypothetical protein -
OHY99_RS04985 (OHY99_04985) 1058712..1059425 + 714 WP_025301780.1 ABC transporter ATP-binding protein -
OHY99_RS04990 (OHY99_04990) 1059422..1060279 + 858 WP_043135664.1 metal ABC transporter permease -
OHY99_RS04995 (OHY99_04995) 1060305..1061183 + 879 WP_049209312.1 metal ABC transporter substrate-binding protein -
OHY99_RS05000 (OHY99_05000) 1061292..1061432 - 141 WP_004940304.1 type B 50S ribosomal protein L36 -
OHY99_RS05005 (OHY99_05005) 1061445..1061699 - 255 WP_004940303.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(8-64)

Antitoxin

Biofilm formation regulator YbaJ

(1-118)


Sequences

Toxin        


Download         Length: 68 a.a.        Molecular weight: 8107.37 Da        Isoelectric Point: 6.9756

>T262131 WP_004940313.1 NZ_CP109824:c1057372-1057169 [Serratia marcescens]
MTKTDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPTSVWKYVR

Download         Length: 204 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 14261.95 Da        Isoelectric Point: 4.4314

>AT262131 WP_004940312.1 NZ_CP109824:c1057791-1057423 [Serratia marcescens]
MDEYSPKRHDIAQLKFLCENLYDEGIATLGDSHHGWVNDPTSSVNLQLNELIEHIASFVMSYKIKYMDESDLSELVEEYL
DDTYTLFSSYGINDSDLRRWQKTKARLFRMFSGEDICTTMKT

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A8B4G7F9

Antitoxin

Source ID Structure
AlphaFold DB A0A2X2G5J9

References