Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 14159..14760 | Replicon | chromosome |
Accession | NZ_CP109824 | ||
Organism | Serratia marcescens strain SMBC31 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A8B4GSJ7 |
Locus tag | OHY99_RS00070 | Protein ID | WP_025304766.1 |
Coordinates | 14159..14539 (-) | Length | 127 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A8B4GSF3 |
Locus tag | OHY99_RS00075 | Protein ID | WP_025304767.1 |
Coordinates | 14539..14760 (-) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OHY99_RS00045 (OHY99_00045) | 9406..10686 | + | 1281 | WP_261456740.1 | DUF3748 domain-containing protein | - |
OHY99_RS00050 (OHY99_00050) | 10717..11064 | - | 348 | WP_016929593.1 | YceK/YidQ family lipoprotein | - |
OHY99_RS00055 (OHY99_00055) | 11374..11787 | + | 414 | WP_004933919.1 | small heat shock chaperone IbpA | - |
OHY99_RS00060 (OHY99_00060) | 11894..12322 | + | 429 | WP_264383768.1 | small heat shock chaperone IbpB | - |
OHY99_RS00065 (OHY99_00065) | 12490..14148 | + | 1659 | WP_025304765.1 | putative transporter | - |
OHY99_RS00070 (OHY99_00070) | 14159..14539 | - | 381 | WP_025304766.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
OHY99_RS00075 (OHY99_00075) | 14539..14760 | - | 222 | WP_025304767.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
OHY99_RS00080 (OHY99_00080) | 14835..16085 | - | 1251 | WP_049207110.1 | valine--pyruvate transaminase | - |
OHY99_RS00085 (OHY99_00085) | 16221..18284 | - | 2064 | WP_264383769.1 | alpha-amylase | - |
OHY99_RS00090 (OHY99_00090) | 18481..18633 | + | 153 | WP_162837931.1 | hypothetical protein | - |
OHY99_RS00095 (OHY99_00095) | 18635..19612 | - | 978 | WP_049204664.1 | glyoxylate/hydroxypyruvate reductase GhrB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 14241.66 Da Isoelectric Point: 7.3173
>T262130 WP_025304766.1 NZ_CP109824:c14539-14159 [Serratia marcescens]
MVAQRALFDTNILIDYLNGIPQARDVLVEYHINPAISAITWMEVMVGAKKQGPALELKTRQFLGQFLLLPITDEVAERAV
ELRHSQHVKLPDAIIWATAQVGFRMLISRNPKDFGTDNGVLMPYRL
MVAQRALFDTNILIDYLNGIPQARDVLVEYHINPAISAITWMEVMVGAKKQGPALELKTRQFLGQFLLLPITDEVAERAV
ELRHSQHVKLPDAIIWATAQVGFRMLISRNPKDFGTDNGVLMPYRL
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A8B4GSJ7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A8B4GSF3 |