Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | FicTA/Fic(toxin) |
| Location | 8139..9030 | Replicon | plasmid pCC20JX12-27K |
| Accession | NZ_CP109815 | ||
| Organism | Campylobacter coli strain CC20JX12 | ||
Toxin (Protein)
| Gene name | Fic | Uniprot ID | - |
| Locus tag | OH128_RS09195 | Protein ID | WP_057030770.1 |
| Coordinates | 8139..8792 (-) | Length | 218 a.a. |
Antitoxin (Protein)
| Gene name | Fti | Uniprot ID | - |
| Locus tag | OH128_RS09200 | Protein ID | WP_057030771.1 |
| Coordinates | 8776..9030 (-) | Length | 85 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OH128_RS09165 (OH128_09165) | 3354..5510 | + | 2157 | WP_057030765.1 | relaxase/mobilization nuclease domain-containing protein | - |
| OH128_RS09170 (OH128_09170) | 5751..5975 | - | 225 | WP_057030766.1 | hypothetical protein | - |
| OH128_RS09175 (OH128_09175) | 5978..6664 | - | 687 | WP_002779831.1 | AAA family ATPase | - |
| OH128_RS09180 (OH128_09180) | 6756..7151 | - | 396 | WP_057030767.1 | conjugal transfer protein TraM | - |
| OH128_RS09185 (OH128_09185) | 7191..7586 | - | 396 | WP_057030768.1 | hypothetical protein | - |
| OH128_RS09190 (OH128_09190) | 7667..8134 | - | 468 | WP_057030769.1 | signal peptidase I | - |
| OH128_RS09195 (OH128_09195) | 8139..8792 | - | 654 | WP_057030770.1 | Fic family protein | Toxin |
| OH128_RS09200 (OH128_09200) | 8776..9030 | - | 255 | WP_057030771.1 | hypothetical protein | Antitoxin |
| OH128_RS09205 (OH128_09205) | 9124..9843 | - | 720 | WP_057030772.1 | conjugal transfer protein TraL | - |
| OH128_RS09210 (OH128_09210) | 9854..11677 | - | 1824 | WP_264378458.1 | type IV secretory system conjugative DNA transfer family protein | - |
| OH128_RS09215 (OH128_09215) | 11674..13887 | - | 2214 | WP_002795783.1 | zincin-like metallopeptidase domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..27725 | 27725 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 218 a.a. Molecular weight: 25091.79 Da Isoelectric Point: 10.1994
>T262129 WP_057030770.1 NZ_CP109815:c8792-8139 [Campylobacter coli]
MKESNEELFKRLITDNKLGIKDEKLFDKESRKYTLTRTKEIIKTPIKGNFDYQHLKNIHKYIFQDVFHWAGKDRMEVGLH
GNFGKYAPNGTITNFVPGKDLNATAQQIFTWLKEDNYLKNSKDLNDFAKNLAEFARNLNALHPFREGNGRTQRIFLNELA
KNAGYKLDLNLIPKDKTIMASVEASQLKLGKLEAIIKTNLKSFRQNLDLEQNKGISL
MKESNEELFKRLITDNKLGIKDEKLFDKESRKYTLTRTKEIIKTPIKGNFDYQHLKNIHKYIFQDVFHWAGKDRMEVGLH
GNFGKYAPNGTITNFVPGKDLNATAQQIFTWLKEDNYLKNSKDLNDFAKNLAEFARNLNALHPFREGNGRTQRIFLNELA
KNAGYKLDLNLIPKDKTIMASVEASQLKLGKLEAIIKTNLKSFRQNLDLEQNKGISL
Download Length: 654 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|