Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazF-pemI/MazF(toxin) |
| Location | 228150..228786 | Replicon | chromosome |
| Accession | NZ_CP109811 | ||
| Organism | Mesobacillus jeotgali strain SBJS01 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | A0A3Q9QS43 |
| Locus tag | FOF60_RS01210 | Protein ID | WP_041967053.1 |
| Coordinates | 228436..228786 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | W4RP20 |
| Locus tag | FOF60_RS01205 | Protein ID | WP_031308192.1 |
| Coordinates | 228150..228431 (+) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FOF60_RS01185 (FOF60_01185) | 224291..224875 | - | 585 | WP_192472909.1 | rhomboid family intramembrane serine protease | - |
| FOF60_RS01190 (FOF60_01190) | 225020..225373 | + | 354 | WP_192472910.1 | holo-ACP synthase | - |
| FOF60_RS01195 (FOF60_01195) | 225565..226578 | + | 1014 | WP_192472911.1 | outer membrane lipoprotein carrier protein LolA | - |
| FOF60_RS01200 (FOF60_01200) | 226801..227958 | + | 1158 | WP_192472912.1 | alanine racemase | - |
| FOF60_RS01205 (FOF60_01205) | 228150..228431 | + | 282 | WP_031308192.1 | hypothetical protein | Antitoxin |
| FOF60_RS01210 (FOF60_01210) | 228436..228786 | + | 351 | WP_041967053.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
| FOF60_RS01215 (FOF60_01215) | 230193..231026 | + | 834 | WP_192472913.1 | RsbT co-antagonist protein RsbRA | - |
| FOF60_RS01220 (FOF60_01220) | 231023..231379 | + | 357 | WP_041967776.1 | STAS domain-containing protein | - |
| FOF60_RS01225 (FOF60_01225) | 231384..231785 | + | 402 | WP_192472914.1 | anti-sigma regulatory factor | - |
| FOF60_RS01230 (FOF60_01230) | 231797..232807 | + | 1011 | WP_192472915.1 | PP2C family protein-serine/threonine phosphatase | - |
| FOF60_RS01235 (FOF60_01235) | 232866..233198 | + | 333 | WP_192472916.1 | anti-sigma factor antagonist | - |
| FOF60_RS01240 (FOF60_01240) | 233195..233668 | + | 474 | WP_079504369.1 | anti-sigma B factor RsbW | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13020.06 Da Isoelectric Point: 4.8998
>T262127 WP_041967053.1 NZ_CP109811:228436-228786 [Mesobacillus jeotgali]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIIAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVDEALQVSLGLIEF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIIAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVDEALQVSLGLIEF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3Q9QS43 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | W4RP20 |