Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
| Location | 353423..353994 | Replicon | chromosome |
| Accession | NZ_CP109802 | ||
| Organism | Enterococcus hirae strain T16-1 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | I6SW09 |
| Locus tag | OKL56_RS01675 | Protein ID | WP_010738536.1 |
| Coordinates | 353423..353764 (-) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | I6T4M0 |
| Locus tag | OKL56_RS01680 | Protein ID | WP_010738535.1 |
| Coordinates | 353764..353994 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OKL56_RS01655 (OKL56_01655) | 348647..349648 | + | 1002 | WP_034866081.1 | aspartate-semialdehyde dehydrogenase | - |
| OKL56_RS01660 (OKL56_01660) | 349645..350994 | + | 1350 | WP_264378875.1 | aspartate kinase | - |
| OKL56_RS01665 (OKL56_01665) | 350954..352063 | + | 1110 | WP_025480561.1 | M20 family metallopeptidase | - |
| OKL56_RS01670 (OKL56_01670) | 352093..353259 | + | 1167 | WP_081123479.1 | pyridoxal phosphate-dependent aminotransferase | - |
| OKL56_RS01675 (OKL56_01675) | 353423..353764 | - | 342 | WP_010738536.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| OKL56_RS01680 (OKL56_01680) | 353764..353994 | - | 231 | WP_010738535.1 | hypothetical protein | Antitoxin |
| OKL56_RS01685 (OKL56_01685) | 354454..355833 | + | 1380 | WP_010738534.1 | FAD-dependent oxidoreductase | - |
| OKL56_RS01690 (OKL56_01690) | 356014..356730 | - | 717 | WP_264378876.1 | AraC family transcriptional regulator | - |
| OKL56_RS01695 (OKL56_01695) | 356819..357499 | - | 681 | WP_001015311.1 | IS6-like element IS1216 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13101.46 Da Isoelectric Point: 10.1962
>T262125 WP_010738536.1 NZ_CP109802:c353764-353423 [Enterococcus hirae]
VPKARNYIPKKGDIVWIDFDPSTGKEIQKRRPGLVVSRYEFNCTTMFAIICPITSTIKNLPTRYSLPKDLDTKGQVLISQ
LKSLDFKERKLKKVENLPLQDMAKIDQIIQYIF
VPKARNYIPKKGDIVWIDFDPSTGKEIQKRRPGLVVSRYEFNCTTMFAIICPITSTIKNLPTRYSLPKDLDTKGQVLISQ
LKSLDFKERKLKKVENLPLQDMAKIDQIIQYIF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7Z9DJ27 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A449E900 |