Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
| Location | 534531..535102 | Replicon | chromosome |
| Accession | NZ_CP109798 | ||
| Organism | Enterococcus faecium strain TF51-2 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | OKL55_RS02605 | Protein ID | WP_002328559.1 |
| Coordinates | 534761..535102 (+) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | A0A828ZZN9 |
| Locus tag | OKL55_RS02600 | Protein ID | WP_002323011.1 |
| Coordinates | 534531..534761 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OKL55_RS02575 (OKL55_02580) | 529649..530977 | + | 1329 | WP_002327663.1 | FAD-containing oxidoreductase | - |
| OKL55_RS02580 (OKL55_02585) | 530999..531625 | + | 627 | WP_002286816.1 | cysteine hydrolase | - |
| OKL55_RS02585 (OKL55_02590) | 531808..532389 | + | 582 | WP_002286813.1 | TetR/AcrR family transcriptional regulator | - |
| OKL55_RS02590 (OKL55_02595) | 533121..533696 | + | 576 | WP_002327664.1 | SOS response-associated peptidase family protein | - |
| OKL55_RS02595 (OKL55_02600) | 533897..534235 | - | 339 | WP_002327665.1 | hypothetical protein | - |
| OKL55_RS02600 (OKL55_02605) | 534531..534761 | + | 231 | WP_002323011.1 | hypothetical protein | Antitoxin |
| OKL55_RS02605 (OKL55_02610) | 534761..535102 | + | 342 | WP_002328559.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| OKL55_RS02610 (OKL55_02615) | 535921..537083 | + | 1163 | WP_086956687.1 | IS3 family transposase | - |
| OKL55_RS02615 (OKL55_02620) | 537214..538398 | + | 1185 | Protein_519 | SpaA isopeptide-forming pilin-related protein | - |
| OKL55_RS02620 (OKL55_02625) | 538398..539711 | + | 1314 | WP_002328556.1 | pilin N-terminal domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13278.70 Da Isoelectric Point: 10.1461
>T262123 WP_002328559.1 NZ_CP109798:534761-535102 [Enterococcus faecium]
VSGERIYIPKKGDIVWIYFDPSLGKEIQKRRPGLVVSRYEFNRKTMFSVICPITSTIKNLPTRYSLPEELDIKGQVIISQ
LKSLDFKERKLKKIENLPLQDMAKIDQIIQYMF
VSGERIYIPKKGDIVWIYFDPSLGKEIQKRRPGLVVSRYEFNRKTMFSVICPITSTIKNLPTRYSLPEELDIKGQVIISQ
LKSLDFKERKLKKIENLPLQDMAKIDQIIQYMF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|