Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1345947..1346864 | Replicon | chromosome |
Accession | NZ_CP109795 | ||
Organism | Bacillus velezensis strain B19 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | I2HQ15 |
Locus tag | L0P93_RS07305 | Protein ID | WP_007407256.1 |
Coordinates | 1346118..1346864 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | I2HQ14 |
Locus tag | L0P93_RS07300 | Protein ID | WP_003154807.1 |
Coordinates | 1345947..1346117 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
L0P93_RS07260 (1341159) | 1341159..1342748 | + | 1590 | WP_029973066.1 | hypothetical protein | - |
L0P93_RS07265 (1342761) | 1342761..1343186 | + | 426 | WP_029973065.1 | hypothetical protein | - |
L0P93_RS07270 (1343191) | 1343191..1343388 | + | 198 | WP_007610833.1 | XkdX family protein | - |
L0P93_RS07275 (1343445) | 1343445..1344206 | + | 762 | WP_104678937.1 | phage portal protein | - |
L0P93_RS07280 (1344258) | 1344258..1344521 | + | 264 | WP_021493821.1 | hemolysin XhlA family protein | - |
L0P93_RS07285 (1344535) | 1344535..1344798 | + | 264 | WP_021493820.1 | phage holin | - |
L0P93_RS07290 (1344812) | 1344812..1345690 | + | 879 | WP_007407257.1 | N-acetylmuramoyl-L-alanine amidase | - |
L0P93_RS07295 (1345725) | 1345725..1345850 | - | 126 | WP_003154809.1 | hypothetical protein | - |
L0P93_RS07300 (1345947) | 1345947..1346117 | - | 171 | WP_003154807.1 | type II toxin-antitoxin system SpoIISB family antitoxin | Antitoxin |
L0P93_RS07305 (1346118) | 1346118..1346864 | - | 747 | WP_007407256.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
L0P93_RS07310 (1346968) | 1346968..1347966 | - | 999 | WP_003154805.1 | inorganic phosphate transporter | - |
L0P93_RS07315 (1347979) | 1347979..1348596 | - | 618 | WP_003154804.1 | DUF47 domain-containing protein | - |
L0P93_RS07320 (1348902) | 1348902..1350190 | - | 1289 | Protein_1382 | amino acid permease | - |
L0P93_RS07325 (1350512) | 1350512..1351462 | + | 951 | WP_104678938.1 | ring-cleaving dioxygenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29077.57 Da Isoelectric Point: 4.7755
>T262115 WP_007407256.1 NZ_CP109795:c1346864-1346118 [Bacillus velezensis]
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVLGSMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYAEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQNRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVLGSMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYAEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQNRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|