Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 533616..534253 | Replicon | chromosome |
Accession | NZ_CP109795 | ||
Organism | Bacillus velezensis strain B19 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | L0P93_RS02845 | Protein ID | WP_003156187.1 |
Coordinates | 533903..534253 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | I2HMS5 |
Locus tag | L0P93_RS02840 | Protein ID | WP_003156188.1 |
Coordinates | 533616..533897 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
L0P93_RS02820 (529982) | 529982..530581 | - | 600 | WP_003156193.1 | rhomboid family intramembrane serine protease | - |
L0P93_RS02825 (530674) | 530674..531039 | + | 366 | WP_014304402.1 | holo-ACP synthase | - |
L0P93_RS02830 (531194) | 531194..532210 | + | 1017 | WP_104679029.1 | outer membrane lipoprotein carrier protein LolA | - |
L0P93_RS02835 (532327) | 532327..533496 | + | 1170 | WP_104679030.1 | alanine racemase | - |
L0P93_RS02840 (533616) | 533616..533897 | + | 282 | WP_003156188.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
L0P93_RS02845 (533903) | 533903..534253 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
L0P93_RS02850 (534371) | 534371..535192 | + | 822 | WP_003156182.1 | STAS domain-containing protein | - |
L0P93_RS02855 (535197) | 535197..535562 | + | 366 | WP_007609584.1 | RsbT antagonist protein RsbS | - |
L0P93_RS02860 (535565) | 535565..535966 | + | 402 | WP_003156178.1 | anti-sigma regulatory factor | - |
L0P93_RS02865 (535978) | 535978..536985 | + | 1008 | WP_007609589.1 | PP2C family protein-serine/threonine phosphatase | - |
L0P93_RS02870 (537049) | 537049..537378 | + | 330 | WP_003156176.1 | anti-sigma factor antagonist RsbV | - |
L0P93_RS02875 (537375) | 537375..537857 | + | 483 | WP_007609591.1 | anti-sigma B factor RsbW | - |
L0P93_RS02880 (537823) | 537823..538611 | + | 789 | WP_029974100.1 | RNA polymerase sigma factor SigB | - |
L0P93_RS02885 (538611) | 538611..539213 | + | 603 | WP_007410234.1 | PP2C family serine/threonine-protein phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T262114 WP_003156187.1 NZ_CP109795:533903-534253 [Bacillus velezensis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|