Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 202625..203250 | Replicon | plasmid pINV |
Accession | NZ_CP109776 | ||
Organism | Shigella sonnei strain CIP_106347 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | Q6XVU6 |
Locus tag | OHN14_RS25500 | Protein ID | WP_000911318.1 |
Coordinates | 202625..203023 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | Q31SG2 |
Locus tag | OHN14_RS25505 | Protein ID | WP_000450530.1 |
Coordinates | 203023..203250 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OHN14_RS25480 (OHN14_25480) | 198637..198975 | + | 339 | Protein_235 | antirestriction protein | - |
OHN14_RS25485 (OHN14_25485) | 199041..200197 | + | 1157 | WP_087879933.1 | IS3-like element IS600 family transposase | - |
OHN14_RS25490 (OHN14_25490) | 200240..200371 | + | 132 | Protein_237 | IS1 family transposase | - |
OHN14_RS25495 (OHN14_25495) | 200397..202616 | + | 2220 | WP_077141270.1 | type IV conjugative transfer system coupling protein TraD | - |
OHN14_RS25500 (OHN14_25500) | 202625..203023 | - | 399 | WP_000911318.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
OHN14_RS25505 (OHN14_25505) | 203023..203250 | - | 228 | WP_000450530.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
OHN14_RS25510 (OHN14_25510) | 203332..207603 | + | 4272 | Protein_241 | conjugative transfer relaxase/helicase TraI | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | ipaH1.4 / tviC / nleE / icsP/sopA / ospB / ospC4 / ospD2 / ospF / ospD1 / ipgB2 / ospE2 / ospC1 / ospD3/senA / ipaH7.8 / ipaH4.5 / ospC2 / ospC3 / ipaJ / ipaA / ipaD / ipaC / ipaB / ipgC / ipgB1 / ipgA / icsB / ipgD / ipgE / ipgF / mxiG / mxiH / mxiI / mxiJ / mxiK / mxiN / mxiL / mxiM / mxiE / mxiD / mxiC / mxiA / spa15 / spa47 / spa13 / spa32 / spa33 / spa24 / spa9 / spa29 / spa40 / virA / icsA/virG / papC / ospI / ipaH9.8 / ospG | 1..214749 | 214749 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14845.09 Da Isoelectric Point: 8.5264
>T262112 WP_000911318.1 NZ_CP109776:c203023-202625 [Shigella sonnei]
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVGGLRTEDWS
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVGGLRTEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|